BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0254 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 29 0.91 SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces po... 26 6.4 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 28.7 bits (61), Expect = 0.91 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 9 QSQPHLPAVHPADQRTRLWQPSPSPSVLSYP 101 QS P + P T + PSPSP+ SYP Sbjct: 307 QSSASHPVLQPPAPSTLQFNPSPSPAAPSYP 337 >SPAC17A2.12 |||ATP-dependent DNA helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 897 Score = 25.8 bits (54), Expect = 6.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 42 ADQRTRLWQPSPSPSVLSYPNSTISYTS 125 A Q +RL P P PS S P TIS S Sbjct: 173 AKQLSRLPTPLPPPSSSSLPTGTISTNS 200 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,014,136 Number of Sequences: 5004 Number of extensions: 60649 Number of successful extensions: 177 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -