Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0252
         (706 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U03849-1|AAA53488.1|  388|Anopheles gambiae putative nucleic aci...    27   0.76 
AY263177-1|AAP78792.1|  699|Anopheles gambiae TmcC-like protein ...    25   1.8  

>U03849-1|AAA53488.1|  388|Anopheles gambiae putative nucleic acid
           binding protein protein.
          Length = 388

 Score = 26.6 bits (56), Expect = 0.76
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = -3

Query: 296 GSCKLPVQASFSLVVSNDHRYSCEDCGNW--HARCRA 192
           G CKLP +   +++ + D  +SC  C N   + RCR+
Sbjct: 42  GCCKLPPELIDAVLSNVDLHWSCIGCTNMLKNPRCRS 78


>AY263177-1|AAP78792.1|  699|Anopheles gambiae TmcC-like protein
           protein.
          Length = 699

 Score = 25.4 bits (53), Expect = 1.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 562 TFFIYYFYVISS 597
           TFFIYY+Y +S+
Sbjct: 574 TFFIYYYYAVST 585


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 631,846
Number of Sequences: 2352
Number of extensions: 10978
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 71922660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)