BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0252 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 4.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 6.5 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 422 NQNSMVVTNSYQHECKEI*CNICTARQ 502 N N+ N+Y + CK++ NI Q Sbjct: 337 NYNNNNYNNNYNNNCKKLYYNIINIEQ 363 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 6.5 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = +2 Query: 374 VLKQETSKALVLSVDVNQNSMVVTNSYQHEC 466 V ++ S +L VN+ + + +Y +EC Sbjct: 457 VSRESNSNQFILMTTVNEGNNNMAATYMNEC 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,980 Number of Sequences: 438 Number of extensions: 3345 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -