BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0250 (752 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24065.1 68416.m03022 expressed protein ; expression supporte... 30 1.4 At2g06860.1 68415.m00768 Ulp1 protease family protein contains P... 30 1.4 >At3g24065.1 68416.m03022 expressed protein ; expression supported by MPSS Length = 135 Score = 30.3 bits (65), Expect = 1.4 Identities = 17/64 (26%), Positives = 39/64 (60%), Gaps = 2/64 (3%) Frame = -1 Query: 362 LINVSLPYFGD-TFTH-IMTIRIKSTLKALDSNPYYWKCFTSLI*K*NGVSMTAKSYISK 189 L++++L + +FT + T+++ + L ALDS+P+ +C +S + + V ++Y+ Sbjct: 11 LVSLALAFTSSLSFTAPVFTVKVTNNL-ALDSHPFTIRCTSSKLDTSSQVLFRGETYVLM 69 Query: 188 YDTE 177 +DT+ Sbjct: 70 FDTD 73 >At2g06860.1 68415.m00768 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 938 Score = 30.3 bits (65), Expect = 1.4 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +3 Query: 372 LSQVSGVNVSPKNTGDTRIVINYDYYN*FKHSTFKSFRYCGCDSMINVD 518 +S V+G SPK +GD V Y YY H TF + C + NVD Sbjct: 483 ISSVTGAVTSPKLSGDNEEVSCYPYYQ--NHYTFIVVQ-CSQQTTTNVD 528 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,431,301 Number of Sequences: 28952 Number of extensions: 264937 Number of successful extensions: 532 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -