BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0249 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier prot... 206 4e-55 L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier prot... 206 4e-55 AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocas... 206 4e-55 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 23 7.4 AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 23 9.8 >L11618-1|AAB04104.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 206 bits (504), Expect = 4e-55 Identities = 98/115 (85%), Positives = 103/115 (89%) Frame = +1 Query: 202 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 381 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 382 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF 546 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYF 115 Score = 85.8 bits (203), Expect = 1e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +2 Query: 584 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 733 TSLCFVYPLDFARTRL ADVG G G+REF+GL +C+ K KSDG+IGLYR Sbjct: 128 TSLCFVYPLDFARTRLGADVGPGAGEREFNGLLDCLKKTVKSDGIIGLYR 177 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +1 Query: 289 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 468 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 469 NFAFKDKYK 495 F D+ K Sbjct: 289 VLVFYDEVK 297 >L11617-1|AAB04105.1| 301|Anopheles gambiae ADP/ATP carrier protein protein. Length = 301 Score = 206 bits (504), Expect = 4e-55 Identities = 98/115 (85%), Positives = 103/115 (89%) Frame = +1 Query: 202 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 381 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 382 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF 546 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYF 115 Score = 85.8 bits (203), Expect = 1e-18 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = +2 Query: 584 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 733 TSLCFVYPLDFARTRL ADVG G G+REF+GL +C+ K KSDG+IGLYR Sbjct: 128 TSLCFVYPLDFARTRLGADVGPGAGEREFNGLLDCLKKTVKSDGIIGLYR 177 Score = 35.5 bits (78), Expect = 0.002 Identities = 22/69 (31%), Positives = 39/69 (56%) Frame = +1 Query: 289 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 468 P + V+ + +Q S ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SWPCKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 469 NFAFKDKYK 495 F D+ K Sbjct: 289 VLVFYDEVK 297 >AY227001-1|AAO32818.2| 301|Anopheles gambiae ADP/ATP translocase protein. Length = 301 Score = 206 bits (504), Expect = 4e-55 Identities = 98/115 (85%), Positives = 103/115 (89%) Frame = +1 Query: 202 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 381 M+ ADP FAKDFLAGGISAAVSKTAVAPIERVKLLLQVQ SKQIA D++YKGIVD F Sbjct: 1 MTKKADPYGFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQAASKQIAVDKQYKGIVDCF 60 Query: 382 VRIPKEQGLLSFWRGNFANVIRYFPTQALNFAFKDKYKQVFLGGVDKKTQFWRYF 546 VRIPKEQG+ +FWRGN ANVIRYFPTQALNFAFKD YKQVFLGGVDK TQFWRYF Sbjct: 61 VRIPKEQGIGAFWRGNLANVIRYFPTQALNFAFKDVYKQVFLGGVDKNTQFWRYF 115 Score = 87.0 bits (206), Expect = 5e-19 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = +2 Query: 584 TSLCFVYPLDFARTRLAADVGKGDGQREFSGLGNCISKIFKSDGLIGLYR 733 TSLCFVYPLDFARTRL ADVG+G G+REF+GL +C+ K KSDG+IGLYR Sbjct: 128 TSLCFVYPLDFARTRLGADVGRGAGEREFNGLLDCLKKTVKSDGIIGLYR 177 Score = 36.7 bits (81), Expect = 7e-04 Identities = 22/69 (31%), Positives = 40/69 (57%) Frame = +1 Query: 289 PIERVKLLLQVQHVSKQIAADQRYKGIVDAFVRIPKEQGLLSFWRGNFANVIRYFPTQAL 468 P + V+ + +Q S + ++ YK +D +V+I K++G +F++G F+NV+R AL Sbjct: 232 PFDTVRRRMMMQ--SGRAKSEVMYKNTLDCWVKIGKQEGSGAFFKGAFSNVLR-GTGGAL 288 Query: 469 NFAFKDKYK 495 F D+ K Sbjct: 289 VLVFYDEVK 297 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +1 Query: 34 EFQKRHTPTLCAPVITKLLQ 93 EFQ+R TP + +++K+ Q Sbjct: 350 EFQRRLTPAMIGELVSKMTQ 369 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 460 QALNFAFKDKYKQVFLGGVDKKTQF 534 Q +NFA+ D + LG D T+F Sbjct: 237 QGINFAWDDGIFSIALGNPDPVTKF 261 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 707,081 Number of Sequences: 2352 Number of extensions: 14997 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -