BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0248 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|S... 132 6e-32 SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosacch... 124 2e-29 SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual 27 1.9 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 4.4 SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosac... 26 5.9 >SPBC4F6.04 |rpl2502|rpl25b, rpl23a-2|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 132 bits (318), Expect = 6e-32 Identities = 66/110 (60%), Positives = 77/110 (70%) Frame = +1 Query: 337 VTKALKAQRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNII 516 V KA AQ+ V KG H K RK+R S FRRPKT E R PKY RKS+P +R+D Y II Sbjct: 3 VGKAKGAQKTVQKGIHNKVARKVRTSTTFRRPKTLELARKPKYARKSVPHASRLDEYKII 62 Query: 517 KFPLTSEAAMKKIEDNNTLVFIVHTSANKHHIKAAVKKLYDINVAKVNTL 666 P+ SE+AMKKIED+NTLVF VH ANK IK AVKKLY ++ K+NTL Sbjct: 63 VNPINSESAMKKIEDDNTLVFHVHLKANKFTIKNAVKKLYSVDAVKINTL 112 >SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 124 bits (298), Expect = 2e-29 Identities = 62/110 (56%), Positives = 74/110 (67%) Frame = +1 Query: 337 VTKALKAQRKVVKGEHGKRVRKIRNSVHFRRPKTFEPPRHPKYPRKSLPKRNRMDAYNII 516 V KA AQ+ V KG H K +K+R S FRRPKT + R PKY RKS+ R+D Y II Sbjct: 3 VAKAKGAQKTVQKGIHNKVAKKVRTSTTFRRPKTLQLSRKPKYARKSVAHAPRLDEYKII 62 Query: 517 KFPLTSEAAMKKIEDNNTLVFIVHTSANKHHIKAAVKKLYDINVAKVNTL 666 P+ SE+AMKKIED+NTLVF VH ANK IK AV+KLY + K+NTL Sbjct: 63 VNPINSESAMKKIEDDNTLVFHVHLKANKFTIKEAVRKLYSVEPVKINTL 112 >SPAC4F8.13c |rng2||IQGAP|Schizosaccharomyces pombe|chr 1|||Manual Length = 1489 Score = 27.5 bits (58), Expect = 1.9 Identities = 19/70 (27%), Positives = 30/70 (42%), Gaps = 2/70 (2%) Frame = -1 Query: 501 IHAISLRQRLPWVFRVPR--RFKRLGSAEMHRVANFPYSLPMFTFYNLPLSLKCFSNRFH 328 + A + R P R P+ RF+ L S++ + + PY+ P F S + + H Sbjct: 196 LRASPVSSRTPSPTRFPKHARFQTLNSSDSASIYSSPYTSPTLEFSKKDASARSDILKMH 255 Query: 327 YFFLSLNPSL 298 S PSL Sbjct: 256 RRTKSATPSL 265 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 26.2 bits (55), Expect = 4.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 237 SQNCQTQASSFQIEDCTEAQKDWD*GTKKS 326 S+NCQ + +++C EA D D G K+ Sbjct: 479 SENCQKLSKQIPLDECNEALFDDDNGDYKA 508 >SPAC18G6.05c |||translation elongation regulator Gcn1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2670 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/51 (17%), Positives = 25/51 (49%) Frame = +1 Query: 496 MDAYNIIKFPLTSEAAMKKIEDNNTLVFIVHTSANKHHIKAAVKKLYDINV 648 + A+++ +F E ++ +DN T I H + ++ + A +++ + Sbjct: 1090 LQAFDLSRFEFIKEIFLELYDDNETNASIAHQISTQNGLDATETSFFELQI 1140 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,005,142 Number of Sequences: 5004 Number of extensions: 38005 Number of successful extensions: 118 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -