BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0245 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 26 1.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 2.5 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 621 INAFFPPLSLLHCFQIVLFNSILSQAGFVSXLVSNTF--WLAS 743 ++ + PP + FQI+L N++++ G ++ F W AS Sbjct: 84 VSVYAPPRFSMEEFQIMLDNTVMAVTGIHKFVIGGDFNAWSAS 126 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.0 bits (52), Expect = 2.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 166 RSTSPLPAPANYQPTTASAS 225 RS +PL A ++Y P TA+A+ Sbjct: 694 RSRTPLTAVSDYSPATAAAA 713 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,203 Number of Sequences: 2352 Number of extensions: 14446 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -