BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0244 (613 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 1.9 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 4.4 AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulf... 24 4.4 AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulf... 24 4.4 AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reduct... 24 4.4 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 23 5.9 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 1.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -1 Query: 466 SKCGSPTPSPGIHRPPSTSSTFSIGNNS 383 S G PTPS H P +S++ SIG S Sbjct: 1347 SSHGGPTPSIISHTPSLSSASGSIGPKS 1374 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 202 PSPQLGFLRSLRLVVGPQGGNNVVH 276 P+P L FLR ++V + G +VH Sbjct: 847 PAPFLQFLRRTKVVTPSESGPIIVH 871 >AJ549085-1|CAD70159.1| 529|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 529 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 565 PDTLSSFDSTAVTEQSSITPTPLSVAS 485 P F A+T++S + PTP + S Sbjct: 503 PTVAEEFTRLAITKRSGLDPTPATCCS 529 >AJ549084-1|CAD70158.1| 505|Anopheles gambiae thioredoxin-disulfide reductase protein. Length = 505 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 565 PDTLSSFDSTAVTEQSSITPTPLSVAS 485 P F A+T++S + PTP + S Sbjct: 479 PTVAEEFTRLAITKRSGLDPTPATCCS 505 >AJ459821-1|CAD30858.1| 502|Anopheles gambiae thioredoxin reductase protein. Length = 502 Score = 23.8 bits (49), Expect = 4.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 565 PDTLSSFDSTAVTEQSSITPTPLSVAS 485 P F A+T++S + PTP + S Sbjct: 476 PTVAEEFTRLAITKRSGLDPTPATCCS 502 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.4 bits (48), Expect = 5.9 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 2/56 (3%) Frame = -1 Query: 595 HSIA--PFVVSTPDTLSSFDSTAVTEQSSITPTPLSVASLIRDIQSKCGSPTPSPG 434 HSI P VS D +SS + + ITP P V S ++ + P+PG Sbjct: 156 HSIPSPPITVSGSD-MSSPGAPTGSSSPQITPRPTPVKSPYEWMKKQSYQSQPNPG 210 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 682,989 Number of Sequences: 2352 Number of extensions: 14507 Number of successful extensions: 29 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -