Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-0240
         (729 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.            23   7.3  
AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript...    23   9.7  

>AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein.
          Length = 3398

 Score = 23.4 bits (48), Expect = 7.3
 Identities = 6/14 (42%), Positives = 10/14 (71%)
 Frame = +3

Query: 585  WLAKFWSKIGDGAL 626
            W+  FW +IG+G +
Sbjct: 1380 WIVSFWVRIGNGEM 1393


>AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase
            protein.
          Length = 1154

 Score = 23.0 bits (47), Expect = 9.7
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = -2

Query: 164  SDWSYVSFAAKNSSKGNTRCRSRYCPILNVKSNFE 60
            ++WS V  AAK  +    RC    C IL  ++  E
Sbjct: 1001 TNWSNVCEAAKRITSKLQRCWDDECAILAAQAMLE 1035


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 749,188
Number of Sequences: 2352
Number of extensions: 15510
Number of successful extensions: 22
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 74428737
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)