BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0240 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 2.9 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 3.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 5.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 22 5.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 22 5.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 6.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 9.0 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 23.0 bits (47), Expect = 2.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -1 Query: 501 HIISTFIAIFGQTIHAIDHFNFKLILLVCRKMVYKS 394 HI+S I AI + LIL+ CRK V KS Sbjct: 37 HIVSIVFYSVLMIISAIGNTTV-LILITCRKRVSKS 71 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 3.9 Identities = 15/47 (31%), Positives = 21/47 (44%), Gaps = 1/47 (2%) Frame = -1 Query: 729 PVNQPGSVAVGLACCWQWNRLHRYR-*TLEVWLDHRARHPQFWTKIS 592 P++ P ++ + CWQ R HR L LD R P KI+ Sbjct: 860 PMDCPEAIYQLMLDCWQKERTHRPTFANLTQTLDKLIRSPDTLRKIA 906 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -1 Query: 276 LYNFFRSVFFRIEH 235 +Y+FF+ FRI+H Sbjct: 337 IYDFFKDSSFRIQH 350 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 22.2 bits (45), Expect = 5.2 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 29 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 169 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 348 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 395 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 22.2 bits (45), Expect = 5.2 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +2 Query: 29 IHENKLS-T*VTQNLI*RLK*DSILIGISCFLY*NS*QQRRHMTSQSS 169 +HE + T + QN+I +K D +L +LY N+ T S+ Sbjct: 386 VHEKQQEITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNNQRTEWSA 433 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 6.8 Identities = 6/14 (42%), Positives = 12/14 (85%) Frame = +1 Query: 400 INHLSTNKEYEFKI 441 +NHL T+ EY++++ Sbjct: 761 VNHLLTHHEYDYEL 774 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 9.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 517 LYFCQLVMSPTDKNYFVGSL 576 LY C + SP D+++ + SL Sbjct: 1065 LYDCYVCYSPNDEDFVLHSL 1084 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,159 Number of Sequences: 438 Number of extensions: 4220 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -