BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0238 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0505 - 4005211-4005234,4005235-4005432,4005522-4006006,400... 29 4.9 03_05_0171 + 21486473-21486775,21486835-21486912,21487223-214874... 29 4.9 >12_01_0505 - 4005211-4005234,4005235-4005432,4005522-4006006, 4006533-4006700,4007128-4007203,4007327-4007409, 4007511-4007589,4007685-4007753,4008174-4008266, 4008668-4008713,4009398-4009522 Length = 481 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +3 Query: 564 DEGSVCEEKYK*QKLVARFLNINKLYHITFIHSC 665 DE SVCE+ K KL L +NK + + H C Sbjct: 267 DETSVCEDYKKISKLFLDMLELNKGHPLYLSHLC 300 >03_05_0171 + 21486473-21486775,21486835-21486912,21487223-21487407, 21487507-21487897 Length = 318 Score = 28.7 bits (61), Expect = 4.9 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = +1 Query: 70 WSSTGPLSRGLLGATSDQTLQLGRPNNALKHNFRDGSQTKSECEPY 207 WS GP G + A + L+ G+P K G T S PY Sbjct: 137 WSGAGP---GFMDAATQGALEAGKPVGGFKIGKEAGEWTTSNFHPY 179 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,233,922 Number of Sequences: 37544 Number of extensions: 322619 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -