BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0235 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 23 3.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 5.6 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 607 HVQWQVGPHPPSAHPTYRSAA 545 H+Q+ PHP +AH S A Sbjct: 113 HMQFMQLPHPAAAHSALLSPA 133 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 5.6 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +3 Query: 381 IYIEQLNDYDAAEKIIEHLESTLEDADGVTPVHGRFYKLASEYYRVRG 524 IY L +A + HL S E+ D V P++ + + + ++ G Sbjct: 186 IYTNLLRIIEADFSKLNHLLSGTENLDLVLPIYSQLVFMCKKINKLYG 233 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,320 Number of Sequences: 336 Number of extensions: 3617 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -