BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0233 (797 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 23 2.8 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 2.8 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 3.7 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 23.0 bits (47), Expect = 2.8 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +1 Query: 148 QKLHYIYTRIQNLKEQVKQQNNQPSTSKTDVSIKNLERN 264 Q Y R Q+ K QQNN P S V++ L R+ Sbjct: 89 QNHRYKTKRAQHEKGMHDQQNNNPLPSPRRVAVPVLVRD 127 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 365 AKEENYYDV*NVKKKEFYLRITQL 436 + EEN + N+KK +F L++ QL Sbjct: 67 SSEENCVSMSNLKKLKFLLKLGQL 90 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -1 Query: 323 FSKVFISFIGCPSQYVFLGMFLSKFFIDTSVLDVE 219 F VF I S Y F + L K ++ ++D+E Sbjct: 101 FVNVFFWVIILMSNYAFTRIILLKSVLEIVIIDIE 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.310 0.130 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,300 Number of Sequences: 336 Number of extensions: 3367 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -