BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0233 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 24 1.4 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.7 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.7 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 24.2 bits (50), Expect = 1.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 532 KDKLIGPVKKTLYTIKNNKIVRLEPMDSSE 621 KDK + P+ K L K+V +E +DS E Sbjct: 171 KDKNMAPILKDLMETSYFKVVVVEDVDSVE 200 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 262 NIPKNTYCDGHPMNDIKTLENCL 330 NI +T DGHP+ND+ + L Sbjct: 61 NIDWST-ADGHPVNDVPGVRRVL 82 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.7 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 262 NIPKNTYCDGHPMNDIKTLENCL 330 NI +T DGHP+ND+ + L Sbjct: 61 NIDWST-ADGHPVNDVPGVRRVL 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.310 0.130 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,850 Number of Sequences: 438 Number of extensions: 4151 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits)
- SilkBase 1999-2023 -