BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0232 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 75 8e-16 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 26 0.48 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.5 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 74.9 bits (176), Expect = 8e-16 Identities = 39/103 (37%), Positives = 62/103 (60%) Frame = +3 Query: 123 SDQTAEIIKQDFDQQVDGSYQFSYETDNGIKAEETGSLKKASGPDASDVIIAQGAFSYTA 302 +D+ A I Q + DG+Y ++ET NGI +E+G K+ D +++QG+ SYTA Sbjct: 23 ADKDAVITSQQLEVNFDGNYINNFETSNGISHQESGQPKQV---DNETPVVSQGSDSYTA 79 Query: 303 PDGTVISLNYVADDDGGFKPEGVHLXXXXXXXXAIQKALDFLA 431 PDG +S+ YVAD++ GF+ +G H+ IQ+AL++ A Sbjct: 80 PDGQQVSITYVADEN-GFQVQGSHIPTAPPIPPEIQRALEWNA 121 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 25.8 bits (54), Expect = 0.48 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +2 Query: 410 EGLRLPCNRASSTILTELILEP-LAGPRLQTTPQPQ 514 +G+RLPC + ++ P L G R +T+P P+ Sbjct: 385 DGIRLPCREVEAAATARNVVAPFLIGSR-RTSPPPE 419 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 207 GIKAEETGSLKKASGPDASDVIIAQGAFSYTAPDGTVISL 326 G+K T +L K S P+ + Q FSY G +++L Sbjct: 262 GLKYYVTPNLSKLSDPEVWIDAVTQIFFSYALGLGALVAL 301 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.5 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 207 GIKAEETGSLKKASGPDASDVIIAQGAFSYTAPDGTVISL 326 G+K T +L K S P+ + Q FSY G +++L Sbjct: 315 GLKYYVTPNLSKLSDPEVWIDAVTQIFFSYALGLGALVAL 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,441 Number of Sequences: 438 Number of extensions: 3930 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -