BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0230 (385 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 2.4 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 3.2 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 20 7.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 20 7.4 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 20 9.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.8 bits (44), Expect = 2.4 Identities = 10/37 (27%), Positives = 13/37 (35%), Gaps = 3/37 (8%) Frame = -3 Query: 335 CPGTTTSGRASVS---C*PPTCPGTGACIQSQTGHXC 234 CP T ++ C P C G C+ G C Sbjct: 248 CPSGTLGYICEINVDDCRPGACHNNGTCLDKVGGFEC 284 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/21 (33%), Positives = 7/21 (33%) Frame = -3 Query: 296 C*PPTCPGTGACIQSQTGHXC 234 C C G C GH C Sbjct: 342 CATSPCQNGGVCTTIHAGHKC 362 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.4 bits (43), Expect = 3.2 Identities = 9/43 (20%), Positives = 17/43 (39%) Frame = +2 Query: 59 TVSDACKTTYEEIKKDKKHRYVVFYIRDEKQIDVETVGERNAE 187 T+S CK + H+ V F +++ ++ G E Sbjct: 31 TISQGCKACGYHSPLESNHKLVTFILKNPPNLNPAVQGSSLTE 73 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 20.2 bits (40), Expect = 7.4 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -2 Query: 219 PFCRSSRNCSYSALRSPTVSTSIC 148 PF SRNC + T +C Sbjct: 427 PFSAGSRNCIGQKFAMLEIKTVLC 450 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 20.2 bits (40), Expect = 7.4 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = -2 Query: 219 PFCRSSRNCSYSALRSPTVSTSIC 148 PF SRNC + T +C Sbjct: 427 PFSAGSRNCIGQKFAMLEIKTVLC 450 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 19.8 bits (39), Expect = 9.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -2 Query: 336 VSGHHDIRKSFCFLLASDVPWHWCVY 259 +S D + CFLL++ + W +Y Sbjct: 37 ISPRCDKISAICFLLSTILGTCWIIY 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,699 Number of Sequences: 336 Number of extensions: 1514 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8014124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -