BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0229 (720 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 3.8 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.7 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 8.9 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = +2 Query: 374 IAGGNNSLPCLEGVKECKKFLMSLGRYGNTPFLW 475 +A N++L + G+K K+ ++ N ++W Sbjct: 341 VAKNNDTLQFISGIKIIKQISSNIYERQNNEYIW 374 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 162 CRFLAPEPTYSPPKRSVSSRK 224 C +P P +PP R S R+ Sbjct: 389 CVACSPPPRQTPPSRKESGRR 409 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/21 (28%), Positives = 10/21 (47%) Frame = +2 Query: 260 YSEEEMNNEFKDWNNKTLKEY 322 Y+ NN + ++NN Y Sbjct: 329 YNNNNYNNNYNNYNNNNYNNY 349 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,668 Number of Sequences: 438 Number of extensions: 4243 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -