BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0221 (699 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 25 0.52 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 25 0.52 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 25 0.69 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 25 0.69 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.69 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 3.7 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 4.9 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 348 VIESISENVLKGNNLRAAFHYCNTNNDVHEYIDKFCKDLCN 470 +I S+S N + NN + ++Y N N + + Y K ++ N Sbjct: 80 IISSLSNNTIHNNNYK--YNYNNNNYNNNNYNKKLYYNIIN 118 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 25.4 bits (53), Expect = 0.52 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 348 VIESISENVLKGNNLRAAFHYCNTNNDVHEYIDKFCKDLCN 470 +I S+S N + NN + ++Y N N + + Y K ++ N Sbjct: 80 IISSLSNNTIHNNNYK--YNYNNNNYNNNNYNKKLYYNIIN 118 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 25.0 bits (52), Expect = 0.69 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +3 Query: 267 KENLLGIQHVTIMQEVQKTQKTEDIQSVIESISENVLKGNNLRAAFHYCNTNND 428 KEN L + I+ E Q+ + T IQ++I+ + +VL NN + +NN+ Sbjct: 336 KENELYANLMKIVHEKQQ-EITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNN 388 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 25.0 bits (52), Expect = 0.69 Identities = 17/54 (31%), Positives = 29/54 (53%) Frame = +3 Query: 267 KENLLGIQHVTIMQEVQKTQKTEDIQSVIESISENVLKGNNLRAAFHYCNTNND 428 KEN L + I+ E Q+ + T IQ++I+ + +VL NN + +NN+ Sbjct: 374 KENELYANLMKIVHEKQQ-EITGLIQNIIQEMKNDVLLSNNDVYLYQNTMSNNN 426 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.0 bits (52), Expect = 0.69 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 3 ITHITEHVGQSGQYEQGILINSHCLDHNLPKM 98 I+H H G+ IN CLD NLPK+ Sbjct: 574 ISHFINHSCDPNLAVYGVWIN--CLDPNLPKL 603 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 3.7 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 60 INSHCLDHNLPKMLDIWQEIFKKPNFSNSERMAMLLNNYCSSLTNGIVSSGHTYAVQAAR 239 ++SH L+HN KM D + + K +++ M L+ +L SS + Y V Sbjct: 224 LSSHTLNHNSDKMSDQQENLTLKE--VDNKVYGMALSPVTHNLYYNSPSSENLYYVN-TE 280 Query: 240 SLISSVDE 263 SL+ S ++ Sbjct: 281 SLMKSENQ 288 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.2 bits (45), Expect = 4.9 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 444 RCIRGHRCLYCNNGMLLANY 385 +C R HR + +NG + AN+ Sbjct: 109 KCPRRHRPVCASNGKIYANH 128 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,717 Number of Sequences: 438 Number of extensions: 4692 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21439440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -