BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0219 (668 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 23 3.0 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 23 3.0 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 5.2 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.1 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 9.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.1 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306 L KLK + G + +A KF K+YV I+ Sbjct: 78 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 108 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 214 LDKLKAERERGITIDIALWKFETSKYYVTII 306 L KLK + G + +A KF K+YV I+ Sbjct: 4 LKKLKFLLKLGQLLGLAPVKFYVQKFYVVIL 34 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 5.2 Identities = 19/66 (28%), Positives = 29/66 (43%), Gaps = 2/66 (3%) Frame = +1 Query: 463 LGVKQLIVGVNKMDSTEPPYSEPRFEEIKKEVSSYIKKIGY--NPXAVAFVPISGWHGDN 636 LG+K L + +++ T Y F K +V ++ G+ + VPISG H D Sbjct: 344 LGMKYLDMVISE---TLRKYPLAPFLNRKSDVKYTFEETGFTLDKGVSIMVPISGLHYDP 400 Query: 637 MLEPSP 654 P P Sbjct: 401 EYYPDP 406 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 21.0 bits (42), Expect = 9.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 629 ETTCWSLHQMPW 664 E CW+ Q PW Sbjct: 187 EYDCWATFQEPW 198 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 321 QRFHQEHDHRNLS 359 + FH+EHD R S Sbjct: 260 RHFHEEHDTRRAS 272 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 579 NLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 478 N L V FLL K L + W G+ +YDE Sbjct: 1276 NALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.1 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = -3 Query: 579 NLLDV*GYFLLDFLKSGLTVWWFSGIHFVYSYDE 478 N L V FLL K L + W G+ +YDE Sbjct: 1276 NALFVLIVFLLTLKKDYLHIKWPFGVKTNITYDE 1309 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,568 Number of Sequences: 336 Number of extensions: 3403 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17385535 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -