BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0218 (697 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy... 31 0.12 SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ... 28 1.5 >SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 31.5 bits (68), Expect = 0.12 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = +2 Query: 221 DVTLAAEGRLLQAHKLVLSVCSPYFQEMF-KMNPTQHPIVFLKDVSHSA--LRDLLQFMY 391 D+ A + + AHK L+ S YF+ F K+ P++H I +V H A +L+++Y Sbjct: 168 DIVFAGQYGRVFAHKFYLAARSSYFKSKFSKLGPSEHEI----EVKHFAKEFESILRYLY 223 >SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1429 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 532 AWPRSRLWFGWRGTFFILITG 470 +W S+LWF + FFI+ITG Sbjct: 215 SWIASKLWFRFFILFFIIITG 235 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,643,509 Number of Sequences: 5004 Number of extensions: 50109 Number of successful extensions: 147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 321151040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -