BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0216 (779 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.8 >SB_49037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2142 Score = 29.1 bits (62), Expect = 4.2 Identities = 19/49 (38%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +2 Query: 8 PRPSDPKPTSPARGAP-CRSTNEALARRGRHGTTVAYIVDDSGSDHKFP 151 PRP +P + RST ALA RG H V D G KFP Sbjct: 1576 PRPESLQPWATRHSVDVARSTGPALASRGTHSAPVFPTNSDQGR-FKFP 1623 >SB_37663| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1735 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +2 Query: 5 LPRPSDPKPTSPARGAP-CRSTNEALARRGRHGTTVAYIVDD 127 LP P D PT P+R P S +A++RRG+ G V D+ Sbjct: 1302 LPEPFDDTPT-PSRPEPGPLSVVKAISRRGKRGGRVVKTKDE 1342 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,947,680 Number of Sequences: 59808 Number of extensions: 393260 Number of successful extensions: 1322 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -