BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0215 (637 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 22 3.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 6.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 6.5 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 8.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 8.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 8.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 8.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 8.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 8.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 8.6 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 8.6 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 8.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 8.6 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 471 VPDIAAPACMRCDAHFTAFRRR 536 +P+I C RCD+ A RR Sbjct: 56 LPEIIGKNCERCDSRQVANARR 77 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +2 Query: 47 RGRPQEHPEVRLPDEPVAGHDGDARTSGEXR 139 RG V L E +G+A+TSG+ R Sbjct: 643 RGADDRAAYVNLLKELRVAFEGEAKTSGQPR 673 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.4 bits (43), Expect = 6.5 Identities = 10/20 (50%), Positives = 10/20 (50%), Gaps = 2/20 (10%) Frame = +3 Query: 504 CDAHFTAFRRRHHC--RNCG 557 CD FRRRHH CG Sbjct: 249 CDKCRGRFRRRHHLVHHKCG 268 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 79 PRSTPPLSTPSNSN 92 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -3 Query: 485 RYVRHPLRSSLHAGVRFTSHARSGT 411 R+ RH ++ H TSH GT Sbjct: 268 RFTRHLIQRRTHTRHTTTSHNTRGT 292 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 240 PRTPPPLSTHYRTN 199 PR+ PPLST +N Sbjct: 123 PRSTPPLSTPSNSN 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,662 Number of Sequences: 336 Number of extensions: 2443 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -