BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0215 (637 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.9 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.9 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.9 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 22 4.3 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 367 CKLTLSIDFLLVSPAGSAAVPLTVSRWIILEL 272 C+LT +++ S GS +PL + + LE+ Sbjct: 188 CQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 367 CKLTLSIDFLLVSPAGSAAVPLTVSRWIILEL 272 C+LT +++ S GS +PL + + LE+ Sbjct: 188 CQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 367 CKLTLSIDFLLVSPAGSAAVPLTVSRWIILEL 272 C+LT +++ S GS +PL + + LE+ Sbjct: 188 CQLTRRQGYVIYSSLGSFFIPLLLMSLVYLEI 219 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 543 CRNCGKVFCASCS 581 C+ CGKV C+ S Sbjct: 8 CQLCGKVLCSKAS 20 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,340 Number of Sequences: 438 Number of extensions: 2942 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -