BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0212 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 26 0.28 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 23 2.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.6 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 8.0 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 26.2 bits (55), Expect = 0.28 Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 4 LFIFCCVLVHFMTHLYTKMSI-DIQGTFVSQKINKVRWIPEDYAETKCFLTGSWDDEVNL 180 ++ FC + F TH Y S+ ++ TF +N VR PE + W+ L Sbjct: 298 IYYFCRAFIIFPTHFYCAFSLYPLKSTFY---LNVVRPFPE---RSMGITPMIWNSTRRL 351 Query: 181 ITVW 192 VW Sbjct: 352 FVVW 355 Score = 24.2 bits (50), Expect = 1.1 Identities = 15/53 (28%), Positives = 24/53 (45%) Frame = -2 Query: 489 VHIAILTNTSYVSFICIQRCCRAFCITVVM*RLPRKYFFKWCLFIISTNFKYF 331 VH+ +L Y ++ + CC T+ + L Y+F +C II YF Sbjct: 250 VHLLLLVCIYYFYYMHLLFCCAFIIFTMHLLFLLCIYYF-YCALIILLCIYYF 301 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 23.4 bits (48), Expect = 2.0 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 541 SCSLHSICYLKHTEVITGNIRGHIK 615 +C L S+CY + + + ++R H + Sbjct: 149 ACGLFSVCYPRVSAQMKADLRSHFR 173 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 22.2 bits (45), Expect = 4.6 Identities = 10/36 (27%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +1 Query: 307 VSISNGDVKILEISAYDKQTPLK--EIFSWKSLHNY 408 +++ N D+ +LE A+ K PL+ +I ++++ N+ Sbjct: 543 LNLKNIDLTVLESGAFCKMQPLRTLKIGVYRNIKNF 578 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -1 Query: 523 YG*LHPFGHSICSHCH 476 YG LH GH S+ H Sbjct: 359 YGDLHNMGHVFISYIH 374 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.317 0.135 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,159 Number of Sequences: 336 Number of extensions: 4576 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -