BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0210 (669 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 2.2 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 6.6 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 6.6 AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 8.7 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 25.0 bits (52), Expect = 2.2 Identities = 8/27 (29%), Positives = 19/27 (70%) Frame = +2 Query: 137 FPNESEKNGKCSSAEYKLEGDVVKVKN 217 + ++ E++ ++AE+ L+ DV++V N Sbjct: 170 YDDDDEEDAAAAAAEFPLQKDVIRVTN 196 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 110 GKLSS*SCSPVSARGRCLRE*LQQSPPQA 24 GKLS + S +S +C+ E L++ PP A Sbjct: 346 GKLSYEAVSEMSYLEQCISETLRKHPPVA 374 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 6.6 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 184 QTGR*RGEGQERAYHRRRQEVYRRDGQAHRRCQ*SRKANSHF 309 Q GR +E RRR+E+ R Q RR + S+ HF Sbjct: 1178 QNGRAVSSAEE--LERRRREMERTRRQRQRRARDSQAITIHF 1217 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 299 TVTFKFGEISRDGSVQILATDYNNYAIAYNCKYDD 403 T+TFK G+ LATDY + + + D Sbjct: 53 TLTFKDGQTYTQAIAFTLATDYGTVRLMSSYNFTD 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,119 Number of Sequences: 2352 Number of extensions: 10840 Number of successful extensions: 20 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -