BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0206 (690 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.6 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 22 6.3 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 8.4 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.4 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.4 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -3 Query: 487 PGPTS*CGLLPTFSTSSGEHKTGLLERITQNKPT 386 P P C T + S + GLL+ T N T Sbjct: 745 PSPAEQCASTTTITARSPQGSQGLLQCATSNYST 778 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 371 YLTSSCPSTCGPT 333 Y+T++ PS CG T Sbjct: 13 YITAAFPSACGKT 25 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 643 ILSWTSFW 666 +LSW SFW Sbjct: 260 VLSWVSFW 267 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +1 Query: 643 ILSWTSFW 666 +LSW SFW Sbjct: 229 VLSWVSFW 236 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = +3 Query: 81 KGASQARLCVHRQQCVPLTLQSHRDYLDRVLASRHVA 191 + +QAR+ + + + LQ RD L ++ HVA Sbjct: 311 RSTAQARVRMQVVSQLEIQLQKERDRLTAMMHHLHVA 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,195 Number of Sequences: 438 Number of extensions: 4626 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -