BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0205 (737 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 27 0.80 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 5.6 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 26.6 bits (56), Expect = 0.80 Identities = 17/57 (29%), Positives = 23/57 (40%) Frame = +1 Query: 256 WNTEECKEYIKPLDKSFEILYGFPLNQILYINIFDKKDIFNVCIKILHEKITVDSLK 426 WN +E E + E Y N IL+ NI+ + V I LH + S K Sbjct: 98 WNKKELNELLVAAKYHDEYGYALSNNTILFGNIYPSAEYIGV-ISRLHSVVEFSSAK 153 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 5.6 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +2 Query: 341 CI*IFLIRKIFSMYALKFYM 400 C+ +FL+ IF+++ + F+M Sbjct: 1756 CLLLFLVMFIFAIFGMSFFM 1775 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,345 Number of Sequences: 2352 Number of extensions: 11517 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -