BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0201 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) 44 1e-04 SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) 38 0.007 SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) 37 0.020 SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) 36 0.046 SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) 36 0.046 SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.061 SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) 35 0.061 SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.081 SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) 34 0.11 SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) 32 0.43 SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) 32 0.57 SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.75 SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) 31 0.99 SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) 30 1.7 SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 30 1.7 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 30 1.7 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 30 1.7 SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) 30 1.7 SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) 30 1.7 SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) 30 2.3 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 4.0 SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) 29 4.0 SB_25675| Best HMM Match : Extensin_2 (HMM E-Value=0.18) 29 4.0 SB_23715| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 29 4.0 SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) 29 4.0 SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) 29 4.0 SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 4.0 SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 29 4.0 SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) 29 4.0 SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) 29 4.0 SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) 29 4.0 SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) 29 5.3 SB_25302| Best HMM Match : Ribosomal_60s (HMM E-Value=0.25) 29 5.3 SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) 28 7.0 SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_35586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_18522| Best HMM Match : DUF960 (HMM E-Value=8.2) 28 7.0 SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) 28 7.0 SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) 28 7.0 SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) 28 7.0 SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 28 7.0 SB_5852| Best HMM Match : 3_5_exonuc (HMM E-Value=3.4e-07) 28 7.0 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) 28 9.2 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) 28 9.2 SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) 28 9.2 SB_20928| Best HMM Match : NHL (HMM E-Value=0) 28 9.2 SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) 28 9.2 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_53750| Best HMM Match : DUF408 (HMM E-Value=5.5) 28 9.2 SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_4351| Best HMM Match : zf-B_box (HMM E-Value=1.3e-25) Length = 662 Score = 44.4 bits (100), Expect = 1e-04 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 13/111 (11%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCLKIKI----EMIKSANSTEFLGAERVTIL--- 609 C +C S S T PKL+ CLHS C CL+ K + + NST + + L Sbjct: 22 CGICRKS--SATSNPKLLPCLHSFCFGCLEEKFDQQQQQEQKQNSTTSSSSASSSPLQRL 79 Query: 610 -CPICRFECQQ-----ANMIDQRFFIEKMALEQVGNNGALSGDQQCNSCED 744 CP C E A +D +F +E + + S D++C SCED Sbjct: 80 KCPTCGQEFLVPPKGIAGFLDNQFMLESLGRQ---TRKKESTDRECTSCED 127 >SB_24396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 4/111 (3%) Frame = +1 Query: 424 GRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVT 603 G +P SL C C+ PK+++CLH+ C+ CL + + LGA + Sbjct: 8 GYSP-QSLNCRACHKVFTE----PKILDCLHTFCQKCL----------GTHDILGAGTNS 52 Query: 604 ILCPICR----FECQQANMIDQRFFIEKMALEQVGNNGALSGDQQCNSCED 744 I+CP+CR + F + AL+Q+ + C +CED Sbjct: 53 IVCPLCRKPTPIPESGVESLPSNFLLNN-ALDQLSVKSSKEYILHCTNCED 102 >SB_39287| Best HMM Match : NHL (HMM E-Value=1.5e-21) Length = 645 Score = 38.3 bits (85), Expect = 0.007 Identities = 33/121 (27%), Positives = 53/121 (43%), Gaps = 4/121 (3%) Frame = +1 Query: 394 SADSLASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANS 573 S S++S ++ L C +C PK++ C H+ C+ CL+ K+ S Sbjct: 3 SGSSISSQSSIEKVREELTCSVCLEQFRE----PKMLPCFHTFCKECLE------KTKQS 52 Query: 574 TEFLGAERVTILCPICRFECQ--QANMIDQ--RFFIEKMALEQVGNNGALSGDQQCNSCE 741 F G +LCP CR + + MI + FI L+ +G SG+ +C SC Sbjct: 53 --FRG----NLLCPTCRTKTSVTEHEMIQKLPNNFIVNRVLDALGAEN--SGELKCGSCN 104 Query: 742 D 744 + Sbjct: 105 E 105 >SB_31924| Best HMM Match : zf-C3HC4 (HMM E-Value=0.00073) Length = 498 Score = 36.7 bits (81), Expect = 0.020 Identities = 33/151 (21%), Positives = 62/151 (41%), Gaps = 11/151 (7%) Frame = +1 Query: 325 PDAPVAGGSSVAEGEAVESNDKGSADSLASPTT--GRAPLSSLRCVLCYNSLASLTGTPK 498 P P++ +V +G + S + + + + TT + + C +C T PK Sbjct: 281 PTTPLSLVQAVFQG--LTSQYRVFEERMMADTTEISKVIIDECTCGVCQEEFNEKTRVPK 338 Query: 499 LMECLHSICETCLKIKI----EMIKSANSTEFLGA-ERVTILCPIC--RFECQQANM--I 651 L+ C H++C+ C+ + M + NS + A + + CP C R +Q N+ + Sbjct: 339 LLHCSHTLCKACVSALLGGGRGMYREMNSNLYGRANDHDSFKCPFCNARQVTEQGNVDNL 398 Query: 652 DQRFFIEKMALEQVGNNGALSGDQQCNSCED 744 I ++ GN A + C+D Sbjct: 399 PNNLTILRLLDFTEGNQAAKELKKMVEKCKD 429 >SB_49217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 35.9 bits (79), Expect = 0.035 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 9/107 (8%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCLKIKI----EMIKSANSTEFLGA-ERVTILCP 615 C +C T PKL+ C H++C+ C+ + M + NS + A + + CP Sbjct: 220 CGVCQEEFNEKTRVPKLLHCSHTLCKACVSALLGGGRGMYREMNSILYGRANDHDSFKCP 279 Query: 616 IC--RFECQQANM--IDQRFFIEKMALEQVGNNGALSGDQQCNSCED 744 C R +Q N+ + I ++ GN A + C+D Sbjct: 280 FCNARQVTEQGNVDNLPNNLTILRLLDFTEGNQAAKELKKMVEKCKD 326 >SB_3354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 632 Score = 35.9 bits (79), Expect = 0.035 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 5/106 (4%) Frame = +1 Query: 436 LSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCP 615 L +L +L +++ P++ CLHS C CL + A S + + I CP Sbjct: 7 LENLEELLTCRQCSNVFKNPRITPCLHSFCAECLN------EIARSRPY----QAYIACP 56 Query: 616 ICRFECQQA-----NMIDQRFFIEKMALEQVGNNGALSGDQQCNSC 738 C++E ++ N + FF+ ++ V + S D C +C Sbjct: 57 TCKYEIRKPEGGLFNTLPPNFFLNRLHDIYVAKRRSYS-DSNCGNC 101 >SB_2107| Best HMM Match : zf-B_box (HMM E-Value=3.9e-08) Length = 599 Score = 35.5 bits (78), Expect = 0.046 Identities = 30/113 (26%), Positives = 50/113 (44%) Frame = +1 Query: 403 SLASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEF 582 S+A T +S + C LC P+++ CLH+ C CL+ +E K + Sbjct: 10 SMADSETTPNNVSDVTCSLCLEQYQD----PRVLACLHTYCRHCLESLVEHSKECTVSCP 65 Query: 583 LGAERVTILCPICRFECQQANMIDQRFFIEKMALEQVGNNGALSGDQQCNSCE 741 E++ I + +ID IEKM+++Q N G +S C +C+ Sbjct: 66 QCREKIEISVEEVKSLKVDFMLID---LIEKMSVDQ-ENKGDIS--ITCETCQ 112 >SB_8285| Best HMM Match : Filamin (HMM E-Value=1.1e-09) Length = 474 Score = 35.5 bits (78), Expect = 0.046 Identities = 20/48 (41%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +1 Query: 406 LASPTTGRA--PLS-SLRCVLCYNSLASLTGTPKLMECLHSICETCLK 540 +AS +T R P+ SL C C N + P+++ CLHSIC+TCL+ Sbjct: 1 MASGSTERVQPPVGVSLYCPACSNVIKD----PRILPCLHSICKTCLE 44 >SB_22639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 956 Score = 35.1 bits (77), Expect = 0.061 Identities = 27/88 (30%), Positives = 39/88 (44%), Gaps = 4/88 (4%) Frame = +1 Query: 373 VESNDKGSADSLASPTTGRAPLSSLR----CVLCYNSLASLTGTPKLMECLHSICETCLK 540 + N S+ SP + L SLR C LC+ + + PK+++C H+ C CL Sbjct: 68 IRGNPSPSSRRERSPLQMASILDSLRQEAECSLCHKTPSE----PKILKCFHTFCNECLT 123 Query: 541 IKIEMIKSANSTEFLGAERVTILCPICR 624 K S EF G + T CP C+ Sbjct: 124 EK--------SAEFKG-DGETFSCPSCK 142 >SB_14351| Best HMM Match : zf-B_box (HMM E-Value=2.3e-12) Length = 549 Score = 35.1 bits (77), Expect = 0.061 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPIC--RFECQQANMIDQRFF 666 P+L+ CLHS+C+ CLK IE A+ I CP+C EC ++ Sbjct: 31 PRLLPCLHSLCKKCLK-DIEQ-----------AQEGAIACPVCLTDVECHLEELLPN--V 76 Query: 667 IEKMALEQVGNNGALSGDQQCNSCE 741 + + L++ N + C CE Sbjct: 77 LARSKLKERENRELAKRAEPCGGCE 101 >SB_37011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1829 Score = 34.7 bits (76), Expect = 0.081 Identities = 29/112 (25%), Positives = 49/112 (43%) Frame = +1 Query: 406 LASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFL 585 +A T +S + C LC P+++ CLH+ C CL+ +E K + Sbjct: 2 MADSETKPKDVSDVTCSLCLGQYQD----PRVLACLHTYCRHCLESLVEHSKECTVSCPQ 57 Query: 586 GAERVTILCPICRFECQQANMIDQRFFIEKMALEQVGNNGALSGDQQCNSCE 741 E++ I + +ID IEKM+++Q N G +S C +C+ Sbjct: 58 CREKIEISVEEVKSLKVDFMLID---LIEKMSVDQ-ENKGDIS--ITCETCQ 103 >SB_37345| Best HMM Match : zf-B_box (HMM E-Value=1.3e-23) Length = 581 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +1 Query: 355 VAEGEAVESNDKGSADSLASPTTGRAPLSSLR--CVLCYNSLASLTGTPKLMECLHSICE 528 +AE + S + D +P + P S++ C LC+ A+ P+L+ CLH+ C+ Sbjct: 111 MAEEHKMASVQRDDLDLGPTPDSPMMPGSNVNLFCPLCHEMFAN----PRLLPCLHTFCK 166 Query: 529 TCLK 540 CL+ Sbjct: 167 RCLE 170 >SB_16508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 33.1 bits (72), Expect = 0.25 Identities = 29/103 (28%), Positives = 43/103 (41%), Gaps = 4/103 (3%) Frame = +1 Query: 445 LRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR 624 L C LC+ + PKL+ CLHS C CL E + + N F CP C Sbjct: 18 LNCSLCHRLIRG----PKLLPCLHSFCLACL----EDLVTENDVGF--------NCPQCH 61 Query: 625 FECQQANM----IDQRFFIEKMALEQVGNNGALSGDQQCNSCE 741 E + + + FF++ M L+ N + S C +C+ Sbjct: 62 TEAKVSKAALRGLPTNFFLDNM-LDIALMNSSDSKPVPCTNCD 103 >SB_14352| Best HMM Match : NHL (HMM E-Value=2.8026e-45) Length = 784 Score = 32.3 bits (70), Expect = 0.43 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPIC 621 PKL+ CLHS C++C++ A TE + + ++CP+C Sbjct: 72 PKLLHCLHSFCQSCIE------GLARKTE---DDCLELICPVC 105 >SB_24395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 31.9 bits (69), Expect = 0.57 Identities = 27/88 (30%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR----FECQQANMIDQR 660 PK++ CLHS C+ CL KS S ERV ++CP C+ + Sbjct: 27 PKVLPCLHSFCQNCLD------KSIRS-----QERV-LVCPTCQCSVPVPAKGIEAFPVN 74 Query: 661 FFIEKMALEQVGNNGALSGDQQCNSCED 744 FFI M A+ +C +CED Sbjct: 75 FFINNMLTVL-----AVQNPTKCTNCED 97 >SB_52478| Best HMM Match : NHL (HMM E-Value=1e-27) Length = 1387 Score = 31.9 bits (69), Expect = 0.57 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 8/106 (7%) Frame = +1 Query: 328 DAPVAGGSSVAEGEAVESNDKGSADSLASPTTG--------RAPLSSLRCVLCYNSLASL 483 D PVA S A A++ +++A+P R+ S C +C S Sbjct: 611 DPPVAAHDS-ASTLALDRGSHDGVNNMAAPEERSKEAEGIIRSAHESSCCPICSRPFKS- 668 Query: 484 TGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPIC 621 PK++ CLH+ C C+K E+++S LG ++T+ CP C Sbjct: 669 ---PKILPCLHTYCSDCVK---EIVRSR-----LG--KLTLQCPKC 701 >SB_5620| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 31.5 bits (68), Expect = 0.75 Identities = 24/72 (33%), Positives = 33/72 (45%), Gaps = 1/72 (1%) Frame = +1 Query: 418 TTGRA-PLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAE 594 TT A L L C +C + PK + C+H +C CL+ +M +S Sbjct: 9 TTAMAVQLDELLCPICLDEFKE----PKTLSCMHDLCRKCLE---DMAARESS------- 54 Query: 595 RVTILCPICRFE 630 RV I CP+CR E Sbjct: 55 RV-IRCPLCRSE 65 >SB_59357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1716 Score = 31.1 bits (67), Expect = 0.99 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCL 537 CVLC L T ++ECLHS C +C+ Sbjct: 1366 CVLCGGYLVDAT---TIVECLHSFCRSCI 1391 >SB_56142| Best HMM Match : zf-B_box (HMM E-Value=2.9e-10) Length = 691 Score = 31.1 bits (67), Expect = 0.99 Identities = 19/75 (25%), Positives = 33/75 (44%) Frame = +1 Query: 406 LASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFL 585 +A+ T + C+LC + P+L+ CLH+ C+ CL+ + + Sbjct: 1 MATSTPQEKDEKDVTCLLCLDIFTD----PRLLPCLHTYCKKCLEDLVSQCQ-------- 48 Query: 586 GAERVTILCPICRFE 630 ++ I CP CR E Sbjct: 49 --KKGEIYCPQCRHE 61 >SB_30772| Best HMM Match : zf-C3HC4 (HMM E-Value=2.4e-09) Length = 207 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 427 RAPLSSLRCVLCYNSLASLTGTPK-LMECLHSICETCL 537 RA LRC +CY + P+ L CLHS C+ CL Sbjct: 60 RALNDELRCSVCYEVFSD----PRTLTACLHSFCKECL 93 >SB_22201| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 604 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 406 LASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIE 552 +A T +S + C LC P+++ CLH+ C CL+ +E Sbjct: 2 MADSETKPKDVSDVTCSLCLEQYQD----PRVLACLHTYCRHCLESLVE 46 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 30.3 bits (65), Expect = 1.7 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +1 Query: 448 RCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRF 627 +C LC L PK++ C H C+ CL+ + T G + + CP C Sbjct: 13 KCSLCSEVLTE----PKILRCFHVYCQKCLQAE---------TNEAGEKSKILKCPCCLE 59 Query: 628 ECQQAN 645 + + AN Sbjct: 60 KTETAN 65 >SB_52170| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 291 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCL 537 CVLC L T ++ECLHS C C+ Sbjct: 48 CVLCGGYLVDAT---TIIECLHSFCRCCI 73 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 445 LRCVLCYNSLASLTGTPKLMECLHSICETCL 537 L C +CY+ P + C H+IC+ CL Sbjct: 12 LTCPICYHEFEDRQRGPISLACGHTICKACL 42 >SB_27080| Best HMM Match : zf-C3HC4 (HMM E-Value=8.1e-10) Length = 462 Score = 30.3 bits (65), Expect = 1.7 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 406 LASPTTGRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIE 552 +A T +S + C LC P+++ CLH+ C CL+ +E Sbjct: 2 MADSETKPKDVSDVTCSLCLEQYQD----PRVLACLHTYCRHCLESLVE 46 >SB_904| Best HMM Match : zf-C3HC4 (HMM E-Value=7.4e-08) Length = 510 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCL 537 CVLC L T ++ECLHS C C+ Sbjct: 16 CVLCGGYLVDAT---TIIECLHSFCRCCI 41 >SB_6802| Best HMM Match : zf-B_box (HMM E-Value=5e-18) Length = 316 Score = 29.9 bits (64), Expect = 2.3 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFE 630 C +C L P+++ CLHS C CL+ E+ + R ++CP+C+ E Sbjct: 15 CSICIEHL----NDPRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAE 60 Query: 631 CQ 636 Q Sbjct: 61 FQ 62 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQQ 639 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q+ Sbjct: 24 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQK 62 >SB_57762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_28248| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 119 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_26592| Best HMM Match : zf-B_box (HMM E-Value=1.3e-18) Length = 355 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +1 Query: 445 LRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR 624 +RC +C P+++ C HS C CL+ E+ + R ++CP+C+ Sbjct: 13 VRCSICIEHF----NDPRVLPCFHSFCRHCLE---ELAVHSEG-------RGKLVCPLCK 58 Query: 625 FECQ 636 E Q Sbjct: 59 AEFQ 62 >SB_25675| Best HMM Match : Extensin_2 (HMM E-Value=0.18) Length = 485 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +E+A++ G L + KE P++ QPP Sbjct: 235 WQPEESTVEKAIIKPGKLTNIEFKETEPEEKQVVKQQPP 273 >SB_23715| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 683 Score = 29.1 bits (62), Expect = 4.0 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +E+A++ G L + KE P++ QPP Sbjct: 552 WQPEESTVEKAIIKPGKLTNIEFKETEPEEKEVVKQQPP 590 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 188 WQPEESTVERAIIKPGKLTNIEFGETEPDGKQVVKQQPP 226 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 400 WQPEESTVERAIIKPGKLTNIEFGETEPDGKEVVKQQPP 438 >SB_18515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_13725| Best HMM Match : zf-B_box (HMM E-Value=6e-14) Length = 594 Score = 29.1 bits (62), Expect = 4.0 Identities = 17/63 (26%), Positives = 26/63 (41%) Frame = +1 Query: 436 LSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCP 615 + + C LC P+++ CLH+ C CL+ +E K T+ CP Sbjct: 11 VKDVTCCLCLEQYQD----PRVLACLHTYCRHCLESLVEHSKEC-----------TVSCP 55 Query: 616 ICR 624 CR Sbjct: 56 QCR 58 >SB_944| Best HMM Match : zf-B_box (HMM E-Value=6.7e-15) Length = 629 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ + A +E G ++CP+C+ E Q Sbjct: 145 PRVLPCLHSFCRHCLE------ELAVHSEGKG----KLVCPLCKSEFQ 182 >SB_53640| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_51226| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 82 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQQA 642 P+++ C HS C CL+ E+ + R ++CP+C+ E Q A Sbjct: 25 PRVLPCFHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQSA 64 >SB_48027| Best HMM Match : zf-C3HC4 (HMM E-Value=4e-10) Length = 62 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_41431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 667 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 30 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 67 >SB_36857| Best HMM Match : zf-C3HC4 (HMM E-Value=2.8e-05) Length = 576 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 493 PK-LMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR 624 PK L C H++C CL E I + NS+ F + CPICR Sbjct: 32 PKSLPSCAHNVCRECL----EKITARNSSRF-------VECPICR 65 >SB_22421| Best HMM Match : zf-B_box (HMM E-Value=4e-17) Length = 463 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQ 636 P+++ CLHS C CL+ E+ + R ++CP+C+ E Q Sbjct: 25 PRVLPCLHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQ 62 >SB_59209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1002 Score = 28.7 bits (61), Expect = 5.3 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 4/64 (6%) Frame = +1 Query: 241 GVTIKEEVP-DDLAEPSAQPPSQLAVGSLPDAPVAGGSSVAEG-EAVE-SNDKGS-ADSL 408 G+T ++ P + PSAQPP+ + + A + G ++ G EAV + GS AD L Sbjct: 184 GITGQDRAPIPPSSSPSAQPPTTTSTTTTTTAAIEGAATTPTGTEAVNVFEESGSPADPL 243 Query: 409 ASPT 420 P+ Sbjct: 244 LLPS 247 >SB_47830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 767 Score = 28.7 bits (61), Expect = 5.3 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 5/88 (5%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQQANMI-----DQ 657 PK + CLH+ C CLK K+ T+ ER+ CP C +E + + Sbjct: 28 PKRLPCLHAFCCHCLK------KTQRGTKL--CERMR--CPTCDYELDLVDSVAIDALPV 77 Query: 658 RFFIEKMALEQVGNNGALSGDQQCNSCE 741 ++I ++ + G L + CNSCE Sbjct: 78 PYYISRVQEIVRCHRGKL--ELACNSCE 103 >SB_35560| Best HMM Match : zf-B_box (HMM E-Value=1e-20) Length = 470 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/64 (26%), Positives = 29/64 (45%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFE 630 C +C P+L+ CLH+ C CL+ + E G + ++CP+C+ E Sbjct: 15 CAICIEHFTD----PRLLPCLHTFCRHCLE---------DLAEHSGKGK--LVCPLCKVE 59 Query: 631 CQQA 642 + A Sbjct: 60 YEIA 63 >SB_25302| Best HMM Match : Ribosomal_60s (HMM E-Value=0.25) Length = 305 Score = 28.7 bits (61), Expect = 5.3 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 368 KQWKAMIKVLQIPWHRP 418 K WK+++KV+ +PW P Sbjct: 65 KMWKSLLKVVDLPWDTP 81 >SB_56478| Best HMM Match : Trypsin (HMM E-Value=0) Length = 968 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +3 Query: 162 FVNGKRELPTEWRRYRTGPDGPGAASWCDHQGRGAR*SGRAK 287 FV K + +W++ RTG DH G G + GR + Sbjct: 342 FVQSKSD-KFDWQKSRTGTPSSNTGPTSDHTGNGGKKDGRGQ 382 >SB_42244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 870 Score = 28.3 bits (60), Expect = 7.0 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 306 LGGWLCTWLGQIIGHLFLDGHTKKRPQV 223 LG W C WLG +I +T++ P + Sbjct: 11 LGSWACAWLGNMISLSVRRENTERSPAI 38 >SB_35586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -2 Query: 319 SQQQVGRVAVHLARPDHRAPLP*WSHQEAAPGPSGPVLYLRHSVGSSR 176 +Q + R+A + R D P+P + + A GP+ P+ Y S G ++ Sbjct: 5 TQSLIARIAGYDIRQDECEPVPERASRSRASGPAHPLPYRIRSAGPAQ 52 >SB_18522| Best HMM Match : DUF960 (HMM E-Value=8.2) Length = 368 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 314 LGVCLMHQSQVDLQWQKGKQWKAMIKVLQIPWHRPP 421 LG C H S+ + W++ + K IKV I H+PP Sbjct: 122 LGHCDRHVSEANYSWRQNLKPKTSIKVFFIR-HKPP 156 >SB_10859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 387 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/60 (31%), Positives = 25/60 (41%) Frame = +1 Query: 445 LRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR 624 + C +CY PK C H+IC CL + +I+ A F CPICR Sbjct: 23 ISCPICYEDFEEPKCLPK---CAHNICRECL---LGIIEKAQLERF--------ECPICR 68 >SB_37498| Best HMM Match : MATH (HMM E-Value=1.8e-28) Length = 562 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 448 RCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANS 573 RC +C + L P C H ICE+C ++ + + + N+ Sbjct: 33 RCTICKHVLQE----PLQTTCGHRICESCFELSLRHLNNNNN 70 >SB_26589| Best HMM Match : DUF477 (HMM E-Value=5.2e-18) Length = 398 Score = 28.3 bits (60), Expect = 7.0 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +1 Query: 424 GRAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIE 552 G+ S C +C T T +L+ C H CE CL +E Sbjct: 253 GKKRYESKSCPICLEEFTPETPT-RLLVCGHKYCEPCLSRWLE 294 >SB_8084| Best HMM Match : EGF_CA (HMM E-Value=2.8026e-45) Length = 3094 Score = 28.3 bits (60), Expect = 7.0 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +1 Query: 280 EPSAQPPSQLA--VGSLPDAPVAGGSSVAEGEAVESNDKGSADSLASPTTGRAPLSSL 447 E +A P S LA + + PD + S+VA V + +S A+P T AP S++ Sbjct: 912 ETTAAPESTLAPDITAAPDTTMVPESTVAPDTTVAPESTVAPESTAAPDTTVAPESTV 969 >SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 3445 Score = 28.3 bits (60), Expect = 7.0 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 268 DDLAEPSAQPPSQLAVGSL--PDAPVAGGSSVAEGEAVESNDKGSADSLASPTTGRAPLS 441 D + S P S +A S D+ VA + +A+G + S + ++ ASP T AP++ Sbjct: 3184 DITPQTSVSPDSTVAPESTVAADSTVASETIIAQGTTLASKTTVATETTASPETTVAPVT 3243 Query: 442 S 444 + Sbjct: 3244 T 3244 >SB_5852| Best HMM Match : 3_5_exonuc (HMM E-Value=3.4e-07) Length = 653 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 172 ENVNFQPSGEDIERALMDLGPLL 240 ENVNF+ GE++ + + +LG LL Sbjct: 562 ENVNFKSHGEEVVKRVRELGKLL 584 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 675 FLNKETLVYHVCLLTFKPAYRTQYC 601 FL K +L YH+ L T K Y+ Q C Sbjct: 194 FLKKSSLTYHLTLHTGKRPYQCQEC 218 >SB_36856| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-05) Length = 406 Score = 27.9 bits (59), Expect = 9.2 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 493 PK-LMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICR 624 PK L C H++C CL E I NS F + CPICR Sbjct: 32 PKSLPSCAHNVCRECL----EKITKRNSIRF-------VECPICR 65 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/73 (26%), Positives = 30/73 (41%) Frame = +1 Query: 427 RAPLSSLRCVLCYNSLASLTGTPKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTI 606 R L C +C + P L+ C HS C C++ E++ + E+ + Sbjct: 12 RGLAEQLMCPVCLGEYKN----PMLLRCYHSFCLRCVQ---ELLHQS-------GEKGVV 57 Query: 607 LCPICRFECQQAN 645 CP CR E + N Sbjct: 58 KCPQCRTEMEIPN 70 >SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) Length = 906 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 509 HSMSLGVPVKLANEL*HSTHLKLDRGARP 423 H+ + G P LA + H T ++LD G RP Sbjct: 184 HTSTWGSPYLLAFKTHHRTRIRLDAGGRP 212 >SB_24224| Best HMM Match : Lectin_C (HMM E-Value=0) Length = 2726 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +1 Query: 358 AEGEAVESNDKGSADSLASPTT 423 A GEAVESND+ + L SPTT Sbjct: 715 ASGEAVESNDQ-QPEPLTSPTT 735 >SB_20928| Best HMM Match : NHL (HMM E-Value=0) Length = 795 Score = 27.9 bits (59), Expect = 9.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 451 CVLCYNSLASLTGTPKLMECLHSICETCL 537 C C N+ + PK++ CLH+ C CL Sbjct: 15 CPKCMNAYEN----PKVLPCLHTFCSQCL 39 >SB_6628| Best HMM Match : zf-C3HC4 (HMM E-Value=1e-09) Length = 89 Score = 27.9 bits (59), Expect = 9.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQQ 639 P+++ C HS C CL+ E+ + R ++CP+C+ E Q+ Sbjct: 25 PRVLPCFHSFCRHCLE---ELAVHSEG-------RGKLVCPLCKAEFQK 63 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 21 WQPEESTVERAIIKPGKLTNIEFGETEPDGKKVVKQQPP 59 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 97 WQPEESTVERAIIKPGKLTNIEFGETEPDGKEVVKQQPP 135 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 173 WQPEESTVERAIIKPGKLTNIEFGETEPDGKEVVKQQPP 211 >SB_53750| Best HMM Match : DUF408 (HMM E-Value=5.5) Length = 274 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 184 FQPSGEDIERALMDLGPLLGVTIKEEVPDDLAEPSAQPP 300 +QP +ERA++ G L + E PD QPP Sbjct: 143 WQPEESTVERAIIKPGKLTNIEFGETEPDGKEVVKQQPP 181 >SB_19932| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2201 Score = 27.9 bits (59), Expect = 9.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 229 PGPSGPVLYLRHSVGSSRFPFTKFSNLRYGA 137 PGP GP +Y R +VG+ TK S + G+ Sbjct: 591 PGPQGPQVYFRRAVGNLNRQETKESVIITGS 621 >SB_18584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1022 Score = 27.9 bits (59), Expect = 9.2 Identities = 19/88 (21%), Positives = 37/88 (42%), Gaps = 4/88 (4%) Frame = +1 Query: 493 PKLMECLHSICETCLKIKIEMIKSANSTEFLGAERVTILCPICRFECQQA----NMIDQR 660 P++ CLHS C+ C+ T+ + + +CP C+ + Q + + Q Sbjct: 415 PRVAPCLHSFCKECV------------TKLVTERQGKFVCPDCQADFQMSVKDVENLSQN 462 Query: 661 FFIEKMALEQVGNNGALSGDQQCNSCED 744 F I + ++ A D +C +C + Sbjct: 463 FSINNLMPILAIHSNASRKDLKCENCNN 490 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,841,182 Number of Sequences: 59808 Number of extensions: 586457 Number of successful extensions: 1740 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1734 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -