BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0201 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 1.9 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 24 5.7 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 5.7 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/45 (28%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +1 Query: 178 VNFQPSGEDIERALMDLGPLLGVTI-KEEVPDDLAEPSAQPPSQL 309 +N S E+ +R + ++ V + K E+PD+ EP + P Q+ Sbjct: 617 INTLVSEEEGQRLVREMKRKFSVIVDKVELPDESGEPVVENPKQI 661 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 514 HSICETCLKIKIEMIKSANSTEFLGAERV 600 H+I E C ++ IE+I +A+ T + ER+ Sbjct: 112 HNISEMCKELGIEVISAASHTLY-NLERI 139 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -2 Query: 346 HLRLVHQANSQQQVGRVAVH 287 H + HQ N QQQ R+ +H Sbjct: 273 HQQWPHQQNGQQQQQRMGIH 292 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 873,519 Number of Sequences: 2352 Number of extensions: 20850 Number of successful extensions: 80 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -