BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0200 (659 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 2.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.2 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -3 Query: 579 RLLEKCFNPRAEFGTRQRSHIKLIFYFNNLCQCFKKRRRVTGSIFKMKV 433 + +EK + E ++ + + N+L +KRR V SIFK++V Sbjct: 49 KAVEKLLTEQKELAEKEEAETLKRYKLNDL----EKRREVYESIFKVEV 93 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -3 Query: 579 RLLEKCFNPRAEFGTRQRSHIKLIFYFNNLCQCFKKRRRVTGSIFKMKV 433 + +EK + E ++ + + N+L +KRR V SIFK++V Sbjct: 209 KAVEKLLTEQKELAEKEEAETLKRYKLNDL----EKRREVYESIFKVEV 253 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = -3 Query: 579 RLLEKCFNPRAEFGTRQRSHIKLIFYFNNLCQCFKKRRRVTGSIFKMKV 433 + +EK + E ++ + + N+L +KRR V SIFK++V Sbjct: 209 KAVEKLLTEQKELAEKEEAETLKRYKLNDL----EKRREVYESIFKVEV 253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,928 Number of Sequences: 336 Number of extensions: 2266 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17073220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -