BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0200 (659 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC30D10.08 |mgm101||mitochondrial nucleoid protein|Schizosacch... 27 1.8 SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Sch... 26 4.2 SPCC1281.07c |||glutathione S-transferase Gst3|Schizosaccharomyc... 26 4.2 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 25 9.7 SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|c... 25 9.7 >SPBC30D10.08 |mgm101||mitochondrial nucleoid protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 267 Score = 27.5 bits (58), Expect = 1.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 83 KNQLLSLKIQKLKYKLPSLKFQKKKNL 3 KN LLS KI + Y+ S+++QK KN+ Sbjct: 40 KNGLLSPKITQRFYQNSSIQYQKDKNI 66 >SPCC1840.12 ||SPCC965.02|OPT oligopeptide transporter family|Schizosaccharomyces pombe|chr 3|||Manual Length = 791 Score = 26.2 bits (55), Expect = 4.2 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 199 VFWGYIVLFGLWYSGYLVVTNW 264 VFW +IVL GL+Y Y V ++ Sbjct: 356 VFWIWIVLPGLYYQNYWQVAHF 377 >SPCC1281.07c |||glutathione S-transferase Gst3|Schizosaccharomyces pombe|chr 3|||Manual Length = 313 Score = 26.2 bits (55), Expect = 4.2 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 569 KNVLTLVPNSARGNDHTLN*YFTLTICVSVLKSGVAS 459 K V+ L P+S R LN YF T+ V K+G A+ Sbjct: 154 KRVVDLYPSSLRTKIDELNDYFYDTVNNGVYKTGFAT 190 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.0 bits (52), Expect = 9.7 Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 135 KSSEIPDAEAKSADI-KVEEPAAQPEDSKTEVQATVAEISKEEKP 4 K S+ P+ + + KVEEP+ + ++ + + TV + +E+ P Sbjct: 446 KPSKEPEVKPTTPSASKVEEPSKKRDEDNHQKEETVTQPKREKTP 490 >SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 117 DAEAKSADIKVE-EPAAQPEDSKTEVQATVAEISKEEKP 4 D + +DIK + E + +DSK +V TV EIS +P Sbjct: 264 DLKDMQSDIKPDVEKSDAMDDSKMKVDYTVNEISNAVQP 302 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,253,368 Number of Sequences: 5004 Number of extensions: 38565 Number of successful extensions: 101 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 299817502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -