BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0196 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosa... 27 3.1 SPCC4G3.03 |||WD repeat protein|Schizosaccharomyces pombe|chr 3|... 26 4.1 SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 26 5.4 >SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 26.6 bits (56), Expect = 3.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +3 Query: 318 SRSERLPEENFEKYQKSSNQLLK 386 S + L +ENFEKYQ+ + ++LK Sbjct: 191 SENANLFKENFEKYQEENAKILK 213 >SPCC4G3.03 |||WD repeat protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 347 Score = 26.2 bits (55), Expect = 4.1 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 572 SPCSVLGHRNVCDVSL*NHSNALSDHRRSPDKTCTAL 462 SP S H +CD H+N + HRR+ D AL Sbjct: 101 SPTSKQTHMKLCD----QHNNGIEIHRRNCDSHAEAL 133 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 25.8 bits (54), Expect = 5.4 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 203 VLRDVTPEISQHMLTELEKLPGVQLGDFLLQFELDEPRE 319 VL D+ P+I Q ++ L L DF+ Q ++E E Sbjct: 1598 VLADLPPKIIQDYYCDMSDLQRKLLNDFVSQLNINEELE 1636 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,326,050 Number of Sequences: 5004 Number of extensions: 42375 Number of successful extensions: 124 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -