BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0196 (652 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016663-5|AAC70880.1| 864|Caenorhabditis elegans Hypothetical ... 31 0.71 U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical pr... 29 2.9 >AF016663-5|AAC70880.1| 864|Caenorhabditis elegans Hypothetical protein F21E9.5 protein. Length = 864 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = -1 Query: 388 LFNSWFDDFWYFSKFSSGNLSDRLTWF 308 LF WF FW FS+FS +L F Sbjct: 838 LFEIWFSQFWKFSEFSVNRFDQKLQEF 864 >U97015-6|AAB52345.2| 1064|Caenorhabditis elegans Hypothetical protein F48C1.1 protein. Length = 1064 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 342 ENFEKYQKSSNQLLKS*KDFLVKIQICMFL 431 E FE+Y KS+NQ+L + F++K + F+ Sbjct: 153 ETFERYTKSTNQILDNMHQFMMKNEKMRFM 182 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,057,814 Number of Sequences: 27780 Number of extensions: 238427 Number of successful extensions: 706 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 619 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -