BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0190 (582 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 4.1 L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. 23 5.5 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 23 7.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 7.2 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 9.5 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 4.1 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Frame = +2 Query: 215 WPKKSAEFLLQLLRNAESNADNKTLDVDRLVI---DHIQVNRAPCLR 346 W + E+L L + A+ N + +++ RLVI D++ V++ P R Sbjct: 1641 WNRWHREYLSTLQKRAKWNKNAISIEPGRLVILQEDNVAVSKWPMAR 1687 >L10440-1|AAA29360.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 301 ASHRPHSGKSRALPTQTYIPCSRS 372 A+ RPH K + L Q PC +S Sbjct: 112 AAKRPHMKKKKVLFHQDNAPCHKS 135 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.0 bits (47), Expect = 7.2 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = +1 Query: 307 HRPHSGKSRALPTQTYIPCSRSHQPLHVVSLPHRSMSQ 420 HR +G+S P+ + ++ HQ + L +R +S+ Sbjct: 195 HRQEAGQSLKGPSNNMLQANKPHQQVDEHELKNRIISK 232 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 7.2 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +1 Query: 91 PSCCSLPQKRD*KERVYSIPSLQRRRWSLC 180 PS L R VYS+ RRRWSLC Sbjct: 9 PSGARLSISRGSPTGVYSV----RRRWSLC 34 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 356 MYVCVGRARDLPECGR*LACQRPKFCCQH 270 ++ VGR R +P+CG L +R H Sbjct: 124 LFYNVGRNRTVPKCGGALISERYVITAAH 152 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,236 Number of Sequences: 2352 Number of extensions: 13024 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -