BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0189 (732 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8ITJ9 Cluster: Transposase; n=7; Arthropoda|Rep: Trans... 100 4e-20 UniRef50_Q61X57 Cluster: Putative uncharacterized protein CBG041... 48 3e-04 UniRef50_Q9TXP4 Cluster: Putative uncharacterized protein; n=1; ... 41 0.036 UniRef50_A4N179 Cluster: Gp20; n=5; Haemophilus influenzae|Rep: ... 33 7.2 >UniRef50_Q8ITJ9 Cluster: Transposase; n=7; Arthropoda|Rep: Transposase - Bombyx mori (Silk moth) Length = 346 Score = 100 bits (239), Expect = 4e-20 Identities = 47/49 (95%), Positives = 47/49 (95%) Frame = -1 Query: 366 PHPNLESLKTSLSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE 220 PHPNLESLKTSL IKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE Sbjct: 300 PHPNLESLKTSL--IKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE 346 >UniRef50_Q61X57 Cluster: Putative uncharacterized protein CBG04119; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG04119 - Caenorhabditis briggsae Length = 312 Score = 47.6 bits (108), Expect = 3e-04 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = -1 Query: 363 HPNLESLKTSLSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE 220 HPN++SLK +L +KA D+D D +R + P RLKACI+ G +FE Sbjct: 264 HPNVDSLKAAL--LKAWDDLDDDYLRRTVASVPARLKACIKAEGSNFE 309 >UniRef50_Q9TXP4 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 459 Score = 40.7 bits (91), Expect = 0.036 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 366 PHPNLESLKTSLSLIKAAADIDMDLVRAAIDDWPRRLKA 250 PH N++SLK SL KA ++D++ +RA +D +PRRL+A Sbjct: 363 PHRNIDSLKDSLK--KAWDELDINYLRATVDSFPRRLEA 399 >UniRef50_A4N179 Cluster: Gp20; n=5; Haemophilus influenzae|Rep: Gp20 - Haemophilus influenzae 22.1-21 Length = 912 Score = 33.1 bits (72), Expect = 7.2 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Frame = +2 Query: 572 NIILVKWWSFTKIF--SVDFLEDPEKLRPAGFVSFSHICA 685 N++LV W K F SV+++EDPE + G++S + + A Sbjct: 99 NVVLVTWNDPKKYFKQSVEYIEDPEAIVKMGYISQTEVVA 138 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,853,469 Number of Sequences: 1657284 Number of extensions: 10280146 Number of successful extensions: 18535 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18533 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 59265488880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -