BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0189 (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_22463| Best HMM Match : VWA (HMM E-Value=0) 28 9.0 >SB_30859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.9 bits (64), Expect = 2.2 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = -1 Query: 354 LESLKTSLSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE 220 +E LKT+++ K A + ++ I ++ RR++ C+Q +GGH E Sbjct: 115 IEKLKTAITA-KINAIPKEECIKV-IQNFARRVQVCLQRNGGHLE 157 >SB_22463| Best HMM Match : VWA (HMM E-Value=0) Length = 1865 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 544 LNEMR*YGMKYNLSKMVVIY*DFFSGLFGGSREVASSGFCFIFP 675 +N++R G YN++ + + D +FGG R+ A F P Sbjct: 1172 INDLRPSGSGYNVADALRVAADHAFTIFGGVRQTAPKTFVLFLP 1215 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,623,519 Number of Sequences: 59808 Number of extensions: 312054 Number of successful extensions: 934 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 934 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -