BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0189 (732 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical ... 41 0.001 Z82085-1|CAB04984.1| 245|Caenorhabditis elegans Hypothetical pr... 28 5.9 >AF098501-8|AAC67403.1| 459|Caenorhabditis elegans Hypothetical protein H28G03.4 protein. Length = 459 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/39 (48%), Positives = 29/39 (74%) Frame = -1 Query: 366 PHPNLESLKTSLSLIKAAADIDMDLVRAAIDDWPRRLKA 250 PH N++SLK SL KA ++D++ +RA +D +PRRL+A Sbjct: 363 PHRNIDSLKDSLK--KAWDELDINYLRATVDSFPRRLEA 399 Score = 30.3 bits (65), Expect = 1.5 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = -1 Query: 309 DIDMDLVRAAIDDWPRRLKACIQNHGGHFE 220 ++++ +RA +D +P+R++ CI+ G FE Sbjct: 419 ELEIPYLRATVDAFPKRVRVCIEADGDIFE 448 >Z82085-1|CAB04984.1| 245|Caenorhabditis elegans Hypothetical protein ZK218.1 protein. Length = 245 Score = 28.3 bits (60), Expect = 5.9 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = -1 Query: 366 PHPNLESLK-----TSLSLIKAAADIDMDLVRAAIDDWPRRLKACIQN 238 P P L++L+ T+ + + ID DLVRAA+ P+ C Q+ Sbjct: 67 PVPGLKTLRPGKCFTTAATAAVTSPIDADLVRAAVSTCPKTCGYCCQS 114 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,285,158 Number of Sequences: 27780 Number of extensions: 252940 Number of successful extensions: 486 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -