BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-0189
(732 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.2
AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.2
AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 6.8
>AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter
transporter-1B protein.
Length = 593
Score = 23.4 bits (48), Expect = 2.2
Identities = 7/13 (53%), Positives = 11/13 (84%)
Frame = -1
Query: 291 VRAAIDDWPRRLK 253
+ AA+D+WPR L+
Sbjct: 400 ITAAVDEWPRLLR 412
>AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter
transporter-1B protein.
Length = 646
Score = 23.4 bits (48), Expect = 2.2
Identities = 7/13 (53%), Positives = 11/13 (84%)
Frame = -1
Query: 291 VRAAIDDWPRRLK 253
+ AA+D+WPR L+
Sbjct: 453 ITAAVDEWPRLLR 465
>AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine
receptor protein.
Length = 694
Score = 21.8 bits (44), Expect = 6.8
Identities = 7/36 (19%), Positives = 22/36 (61%)
Frame = -3
Query: 199 IYVLLSSFWYMNGYIMNKLVSVILH*TCDRIYDLTS 92
+YVL++ W + G++ + +++ + + I++L +
Sbjct: 244 VYVLVNGSWSLPGFVCDFYIAMDVTCSTSSIFNLVA 279
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 174,491
Number of Sequences: 438
Number of extensions: 3465
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22779405
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -