BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0186 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.95 EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. 23 2.2 AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. 23 2.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 8.9 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 24.6 bits (51), Expect = 0.95 Identities = 19/77 (24%), Positives = 36/77 (46%) Frame = +3 Query: 483 SAM*SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLPQKKRNTFHLSSA 662 +A+ S PPP F + + + S ++++ R + + +A M +P N ++S Sbjct: 374 TALMSQPPPNFGVSQVSPVSMSALVSAVRSPAGGQLPPSAGAPMPPIP----NMSNMSGM 429 Query: 663 KPIRRQSTMLGSKPSEP 713 P+ M GS P+ P Sbjct: 430 PPL---PNMPGSMPTMP 443 >EF032397-1|ABM97933.1| 200|Apis mellifera arginine kinase protein. Length = 200 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 700 FDPSIVDCLLIGFALLRWNVFLFFCGKDVITLFA 599 FD +++DC+ G L V ++ + TLFA Sbjct: 29 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 62 >AF023619-1|AAC39040.1| 355|Apis mellifera arginine kinase protein. Length = 355 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -1 Query: 700 FDPSIVDCLLIGFALLRWNVFLFFCGKDVITLFA 599 FD +++DC+ G L V ++ + TLFA Sbjct: 45 FDSTLLDCIQSGIENLDSGVGIYAPDAEAYTLFA 78 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.4 bits (43), Expect = 8.9 Identities = 8/26 (30%), Positives = 12/26 (46%) Frame = +1 Query: 262 LPHSGENPCLIWWPSIQQACTQDPTQ 339 +P +NP + W AC+ P Q Sbjct: 373 IPEPSKNPAMGHWQMSCVACSPPPRQ 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,439 Number of Sequences: 438 Number of extensions: 3856 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -