BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0185 (678 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 24 1.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.5 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 8.2 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 24.2 bits (50), Expect = 1.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 232 PVRPPYSWAALKATQTQAY 288 P +PP++W LKA + + Sbjct: 218 PYQPPFAWKILKAAEEAGF 236 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +1 Query: 190 CRPSPRSRTLAAPSPVRPPYSWAALKATQT 279 C P P + P+ PP S +L AT T Sbjct: 79 CDPVPGNLEQIGSRPLHPPASSTSLPATIT 108 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 326 QVLLFIVRFWT 358 QV+LFIV WT Sbjct: 161 QVILFIVLIWT 171 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,005 Number of Sequences: 438 Number of extensions: 3714 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20586735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -