BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0184 (797 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.5 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 23 4.3 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.4 bits (48), Expect = 2.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 320 TDKLQ*VQASSRIFRRQLESGLNALHADFDTLS 222 +D + + SRI ++ S LNA+++ FDTL+ Sbjct: 428 SDVVTFTEICSRITPMEVVSMLNAMYSLFDTLT 460 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.6 bits (46), Expect = 4.3 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 333 PPANKAEAERLKNEGNELMKAERYNEA 413 PP ++A E +K E + +K YN A Sbjct: 160 PPYSEARFEEIKKEVSSYIKKIGYNTA 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,317 Number of Sequences: 438 Number of extensions: 3464 Number of successful extensions: 43 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -