BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0182 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, put... 162 2e-40 At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, put... 161 4e-40 At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, put... 161 4e-40 At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, put... 161 4e-40 At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putati... 54 7e-08 At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putati... 52 3e-07 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 37 0.014 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 36 0.032 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 36 0.032 At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putati... 31 0.52 At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putati... 30 1.2 At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putati... 30 1.2 At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putati... 30 1.2 At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, puta... 28 4.9 At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, puta... 28 4.9 >At2g47640.1 68415.m05944 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 109 Score = 162 bits (393), Expect = 2e-40 Identities = 80/109 (73%), Positives = 89/109 (81%), Gaps = 1/109 (0%) Frame = +2 Query: 71 TKPRSEMTLXXLSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCN 250 +KP E T K EEEEF+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCN Sbjct: 2 SKPMEEDT--NQGKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCN 59 Query: 251 MVLENVKEMWTEVPRT-XXXXXXXAVNKDKFISKMFLRGDSVILVLRNP 394 MVLENV+EMWTEVP+T VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 60 MVLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNP 108 >At3g62840.1 68416.m07060 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 161 bits (391), Expect = 4e-40 Identities = 80/109 (73%), Positives = 89/109 (81%), Gaps = 1/109 (0%) Frame = +2 Query: 71 TKPRSEMTLXXLSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCN 250 +KP E T K EEEEF+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCN Sbjct: 2 SKPMEEDTN---GKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCN 58 Query: 251 MVLENVKEMWTEVPRT-XXXXXXXAVNKDKFISKMFLRGDSVILVLRNP 394 MVLENV+EMWTEVP+T VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 59 MVLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At2g47640.3 68415.m05946 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 161 bits (391), Expect = 4e-40 Identities = 80/109 (73%), Positives = 89/109 (81%), Gaps = 1/109 (0%) Frame = +2 Query: 71 TKPRSEMTLXXLSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCN 250 +KP E T K EEEEF+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCN Sbjct: 2 SKPMEEDTN---GKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCN 58 Query: 251 MVLENVKEMWTEVPRT-XXXXXXXAVNKDKFISKMFLRGDSVILVLRNP 394 MVLENV+EMWTEVP+T VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 59 MVLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At2g47640.2 68415.m05945 small nuclear ribonucleoprotein D2, putative / snRNP core protein D2, putative / Sm protein D2, putative similar to small nuclear ribonucleoprotein Sm D2 (snRNP core protein D2) (Sm-D2) [Mus musculus] SWISS-PROT:P43330 Length = 108 Score = 161 bits (391), Expect = 4e-40 Identities = 80/109 (73%), Positives = 89/109 (81%), Gaps = 1/109 (0%) Frame = +2 Query: 71 TKPRSEMTLXXLSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCN 250 +KP E T K EEEEF+TGPLSVL SVKNNTQVLINCRNN+KLLGRV+AFDRHCN Sbjct: 2 SKPMEEDTN---GKTEEEEFNTGPLSVLMMSVKNNTQVLINCRNNRKLLGRVRAFDRHCN 58 Query: 251 MVLENVKEMWTEVPRT-XXXXXXXAVNKDKFISKMFLRGDSVILVLRNP 394 MVLENV+EMWTEVP+T VN+D+FISKMFLRGDSVI+VLRNP Sbjct: 59 MVLENVREMWTEVPKTGKGKKKALPVNRDRFISKMFLRGDSVIIVLRNP 107 >At1g76860.1 68414.m08944 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 98 Score = 54.4 bits (125), Expect = 7e-08 Identities = 34/98 (34%), Positives = 54/98 (55%) Frame = +2 Query: 116 EEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPR 295 EEE PL ++ S+ + ++ + R++++L G++ AFD+H NM+L +V+E T V Sbjct: 4 EEEATVREPLDLIRLSL--DERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVEI 61 Query: 296 TXXXXXXXAVNKDKFISKMFLRGDSVILVLRNPLATAA 409 + I +F+RGD VILV PL TAA Sbjct: 62 DDETYEEIVRTTKRTIEFLFVRGDGVILV-SPPLRTAA 98 >At1g21190.1 68414.m02649 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to SWISS-PROT:Q9Y4Z1 U6 snRNA-associated Sm-like protein LSm3 (MDS017) [Mouse] Length = 97 Score = 52.0 bits (119), Expect = 3e-07 Identities = 29/97 (29%), Positives = 54/97 (55%) Frame = +2 Query: 113 IEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVP 292 +EE+ PL ++ S++ ++ + R++++L G++ AFD+H NM+L +V+E+ T + Sbjct: 3 VEEDATVREPLDLIRLSIEE--RIYVKLRSDRELRGKLHAFDQHLNMILGDVEEVITTIE 60 Query: 293 RTXXXXXXXAVNKDKFISKMFLRGDSVILVLRNPLAT 403 + + +F+RGD VILV PL T Sbjct: 61 IDDETYEEIVRTTKRTVPFLFVRGDGVILV-SPPLRT 96 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 36.7 bits (81), Expect = 0.014 Identities = 18/68 (26%), Positives = 35/68 (51%) Frame = +2 Query: 173 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 352 N ++ + ++ ++L+G+ AFDRH N+VL + +E P + + + + Sbjct: 14 NYRMRVTIQDGRQLIGKFMAFDRHMNLVLGDCEEFRKLPPAKGNKKTNEEREERRTLGLV 73 Query: 353 FLRGDSVI 376 LRG+ VI Sbjct: 74 LLRGEEVI 81 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/68 (26%), Positives = 37/68 (54%) Frame = +2 Query: 173 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 352 N ++ + ++ ++L+G+ AFDRH N+VL + +E + ++P + + + Sbjct: 14 NYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEE-FRKLPPAKGKKINEEREDRRTLGLV 72 Query: 353 FLRGDSVI 376 LRG+ VI Sbjct: 73 LLRGEEVI 80 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.5 bits (78), Expect = 0.032 Identities = 18/68 (26%), Positives = 37/68 (54%) Frame = +2 Query: 173 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPRTXXXXXXXAVNKDKFISKM 352 N ++ + ++ ++L+G+ AFDRH N+VL + +E + ++P + + + Sbjct: 14 NYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEE-FRKLPPAKGKKINEEREDRRTLGLV 72 Query: 353 FLRGDSVI 376 LRG+ VI Sbjct: 73 LLRGEEVI 80 >At5g48870.1 68418.m06045 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm5 [Homo sapiens] SWISS-PROT:Q9Y4Y9 Length = 88 Score = 31.5 bits (68), Expect = 0.52 Identities = 13/33 (39%), Positives = 24/33 (72%) Frame = +2 Query: 176 TQVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 274 +++ + + +K+L+G +K FD + NMVLE+V E Sbjct: 20 SKIWVIMKGDKELVGILKGFDVYVNMVLEDVTE 52 >At3g14080.2 68416.m01780 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +2 Query: 179 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 274 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At3g14080.1 68416.m01779 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116; contains Pfam profile: PF01423 Sm protein Length = 128 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +2 Query: 179 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 274 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGTLRSFDQFANAVLEGACE 53 >At1g19120.1 68414.m02378 small nuclear ribonucleoprotein, putative / snRNP, putative / Sm protein, putative similar to U6 snRNA-associated Sm-like protein LSm1 (Small nuclear ribonuclear CaSm, Cancer-associated Sm-like) [Homo sapiens] SWISS-PROT:O15116 Length = 128 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +2 Query: 179 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKE 274 ++L+ R+ +KL+G +++FD+ N VLE E Sbjct: 22 KLLVLLRDGRKLMGLLRSFDQFANAVLEEAYE 53 >At4g30330.1 68417.m04311 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +2 Query: 104 LSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLL--GRVKAFDRHCNMVLENVKEM 277 ++ + + T P++++ + +++ ++ I K L GR+ FD + N+VL+ +E+ Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV 60 >At2g18740.1 68415.m02182 small nuclear ribonucleoprotein E, putative / snRNP-E, putative / Sm protein E, putative similar to SWISS-PROT:P08578 small nuclear ribonucleoprotein E (snRNP-E) (Sm protein E, Sm-E, SmE) [Chicken] Length = 88 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/60 (21%), Positives = 33/60 (55%), Gaps = 2/60 (3%) Frame = +2 Query: 104 LSKIEEEEFSTGPLSVLTQSVKNNTQVLINCRNNKKLL--GRVKAFDRHCNMVLENVKEM 277 ++ + + T P++++ + +++ ++ I K L GR+ FD + N+VL+ +E+ Sbjct: 1 MASTKVQRIMTQPINLIFRFLQSKARIQIWLFEQKDLRIEGRITGFDEYMNLVLDEAEEV 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,194,455 Number of Sequences: 28952 Number of extensions: 257469 Number of successful extensions: 558 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -