BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0179 (708 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 7.4 AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 9.8 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 9.8 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 Query: 433 WKKGYDKGDIKGHVYDDVLPALEQWRSVEGQKIYI 537 W KG D+ VY D + SVE + Y+ Sbjct: 468 WHKGMDESGSPYMVYGDQWVGYDDSESVEKKVNYV 502 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 249 FFDILIIPLGIKKIFHIFFSIRK*FVLNKADRCCS 145 FF ++++ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 249 FFDILIIPLGIKKIFHIFFSIRK*FVLNKADRCCS 145 FF ++++ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 249 FFDILIIPLGIKKIFHIFFSIRK*FVLNKADRCCS 145 FF ++++ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 7.4 Identities = 8/35 (22%), Positives = 18/35 (51%) Frame = -1 Query: 249 FFDILIIPLGIKKIFHIFFSIRK*FVLNKADRCCS 145 FF ++++ + +FH F +I + + CC+ Sbjct: 1333 FFALILVIQFVAMLFHRFGTIAHILASTELNLCCT 1367 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 659 LVASCLAPTAVSKWPSMRGSRSPA 588 L++ L KW MR + SPA Sbjct: 71 LLSEALTNLPGEKWKEMRATLSPA 94 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 365 RMSNGRCRPTVKLPL*SNSRGLS 433 R+ RC P LPL +R LS Sbjct: 179 RLREERCDPDRPLPLDQKARDLS 201 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,764 Number of Sequences: 336 Number of extensions: 3662 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -