BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0179 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 23 2.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 3.7 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 8.7 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 23.4 bits (48), Expect = 2.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 513 SRGSEDLHLLLWIRPSPETSFWP 581 S G+ED +LLL R +P +S P Sbjct: 259 SGGNEDANLLLKARLNPNSSLQP 281 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 205 KDFLDAQWDDEDVKEAVNALRKLAIEDQEKS 297 KD W DE + A++ALR I + S Sbjct: 458 KDGPTKSWSDESLNNALDALRTGTISANKAS 488 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/23 (26%), Positives = 14/23 (60%) Frame = +1 Query: 433 WKKGYDKGDIKGHVYDDVLPALE 501 W + KGD++ + +++P L+ Sbjct: 587 WANVFAKGDMEAFLVKNIIPKLQ 609 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,249 Number of Sequences: 438 Number of extensions: 4223 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -