BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0178 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyce... 28 1.5 SPBC646.07c |||enoyl reductase|Schizosaccharomyces pombe|chr 2||... 27 2.5 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 26 4.4 SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 7.8 >SPAC30D11.10 |rad22||DNA repair protein Rad22|Schizosaccharomyces pombe|chr 1|||Manual Length = 469 Score = 27.9 bits (59), Expect = 1.5 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 9/70 (12%) Frame = +3 Query: 114 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVALAKVPN------AEDKLKVEKLIDA- 272 DF EN+ + +L + + ++ KDG + +D+ + N A +K K E DA Sbjct: 84 DFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDAL 143 Query: 273 --CLANKGNS 296 L N GNS Sbjct: 144 KRALRNFGNS 153 >SPBC646.07c |||enoyl reductase|Schizosaccharomyces pombe|chr 2|||Manual Length = 295 Score = 27.1 bits (57), Expect = 2.5 Identities = 13/38 (34%), Positives = 16/38 (42%) Frame = +1 Query: 466 NLVWCYYSNFNLYLXDKFCFVVVTYSIENRNLIFFCVH 579 N W Y ++NL L K FV+V R VH Sbjct: 104 NYKWIYRKDYNLCLNQKIAFVLVMLHFMKREYESIFVH 141 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 26.2 bits (55), Expect = 4.4 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 547 ENRNLIFFCVHH 582 EN+N + FC+HH Sbjct: 1439 ENKNYVLFCIHH 1450 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.4 bits (53), Expect = 7.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 613 PRNIKRDKQSYDEHKRKLNFCSQLNMLQQQNKIYRXD 503 P ++ D H +KLN SQLN + + + + D Sbjct: 321 PLESRKLHSKVDVHSKKLNALSQLNPILRSENVLQND 357 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,600,567 Number of Sequences: 5004 Number of extensions: 50915 Number of successful extensions: 133 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -