BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0176 (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_01_0206 + 1388149-1388330,1388527-1388629,1388896-1388964,138... 31 1.0 >02_01_0206 + 1388149-1388330,1388527-1388629,1388896-1388964, 1389684-1389803,1390352-1390482,1390840-1390881, 1390961-1391138,1391241-1391319,1391441-1391610, 1392503-1392629,1392731-1392846,1392926-1393033, 1393118-1393180,1393283-1393456,1393814-1393978 Length = 608 Score = 30.7 bits (66), Expect = 1.0 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = -1 Query: 555 NVLKNISQFVKSSLFKQLKFMLLSNPSKEE 466 +VL N+ QFVK S FKQ L++ KEE Sbjct: 419 SVLSNMRQFVKYSRFKQFALRALASTLKEE 448 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,556,199 Number of Sequences: 37544 Number of extensions: 224406 Number of successful extensions: 404 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 404 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -