BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0176 (648 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-853|AAF58946.1| 188|Drosophila melanogaster CG8800-PA ... 30 3.1 AY061402-1|AAL28950.1| 675|Drosophila melanogaster LD33040p pro... 29 5.4 AE014298-1930|AAF48292.1| 675|Drosophila melanogaster CG9938-PA... 29 5.4 >AE013599-853|AAF58946.1| 188|Drosophila melanogaster CG8800-PA protein. Length = 188 Score = 29.9 bits (64), Expect = 3.1 Identities = 17/54 (31%), Positives = 34/54 (62%), Gaps = 5/54 (9%) Frame = -1 Query: 558 NNVLKNISQFVKSSLFKQLK-FMLLSNPSKEEINEPLW---CME-LEAPRELNG 412 NN++K+ S+F + + + L+ +++ NP E ++EP W C++ L R+L+G Sbjct: 124 NNLIKDWSEFNRLAEIESLEDLVVVGNPLSEGLDEPTWRAECIKRLPTIRKLDG 177 >AY061402-1|AAL28950.1| 675|Drosophila melanogaster LD33040p protein. Length = 675 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 540 ISQFVKSSLFKQLKFMLLSNPSKEEINEPLWCMEL 436 I +KS + +Q L NP++E+I+E + C+EL Sbjct: 462 ICGLIKSGIGQQSDLTLPLNPNQEDISERVQCLEL 496 >AE014298-1930|AAF48292.1| 675|Drosophila melanogaster CG9938-PA protein. Length = 675 Score = 29.1 bits (62), Expect = 5.4 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -1 Query: 540 ISQFVKSSLFKQLKFMLLSNPSKEEINEPLWCMEL 436 I +KS + +Q L NP++E+I+E + C+EL Sbjct: 462 ICGLIKSGIGQQSDLTLPLNPNQEDISERVQCLEL 496 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,852,453 Number of Sequences: 53049 Number of extensions: 421061 Number of successful extensions: 635 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2744900550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -