BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0169 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 3.1 AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 23 9.4 AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. 23 9.4 AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. 23 9.4 AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. 23 9.4 AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. 23 9.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 9.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 3.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -1 Query: 220 SASLTTYSLPPAECAEP 170 SA+ T+ LPP EC +P Sbjct: 27 SANENTHYLPPLECVDP 43 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 23.0 bits (47), Expect = 9.4 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +1 Query: 631 YCGSIVKDYHTS 666 YCG + D+HTS Sbjct: 39 YCGKALDDFHTS 50 >AY341205-1|AAR13769.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 99 NCSSESCDEMMSVLERTITSPGFMGSAHSAGG 194 N SSES +M S T + G G+ S+GG Sbjct: 232 NFSSESNAQMDSTTNTTSNTGGTGGTGTSSGG 263 >AY341204-1|AAR13768.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 99 NCSSESCDEMMSVLERTITSPGFMGSAHSAGG 194 N SSES +M S T + G G+ S+GG Sbjct: 232 NFSSESNAQMDSTTNTTSNTGGTGGTGTSSGG 263 >AY341203-1|AAR13767.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 99 NCSSESCDEMMSVLERTITSPGFMGSAHSAGG 194 N SSES +M S T + G G+ S+GG Sbjct: 232 NFSSESNAQMDSTTNTTSNTGGTGGTGTSSGG 263 >AY341202-1|AAR13766.1| 285|Anopheles gambiae period protein. Length = 285 Score = 23.0 bits (47), Expect = 9.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 99 NCSSESCDEMMSVLERTITSPGFMGSAHSAGG 194 N SSES +M S T + G G+ S+GG Sbjct: 232 NFSSESNAQMDSTTNTTSNTGGTGGTGTSSGG 263 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 9.4 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 415 LVSIALDISRLKQYTGRDEPTVIT*SYNEKT*HELKLYTQY 537 L +IAL + RL + RDE +V+ S + HEL L +Y Sbjct: 753 LFNIALVLQRLATFVLRDEKSVL--SVVLQAVHELGLAHKY 791 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,688 Number of Sequences: 2352 Number of extensions: 9207 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -