BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0166 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 2.9 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 22 6.6 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 22 6.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 6.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.7 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 23.0 bits (47), Expect = 2.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 639 VLSIDSLSYLSFTYSIHTFSIPPW 710 VLSIDS++ S TY F W Sbjct: 38 VLSIDSINEESMTYVADIFLAQSW 61 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +3 Query: 594 NTNNFIENI*VFIGHVLSIDSLSYLS 671 N N FI NI V +G D+ +Y+S Sbjct: 185 NMNTFIANIAVDLGKGGCNDAFAYMS 210 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.8 bits (44), Expect = 6.6 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 415 LSKKVFVKEGGSEDDDKDSLKADRNRLILRQTSV 516 L KV + +EDD+ + D+ + R TSV Sbjct: 362 LDSKVSARIEMNEDDNTSLVSLDKKQYTWRHTSV 395 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 6.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 65 VAEHLVKNRLEWFIENNN 12 V EH KN+ EW +NN Sbjct: 1495 VVEHKKKNQQEWNQVSNN 1512 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 8.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 21 FNKPFQTILHKMFSNLS 71 F KPF+ IL+ SNL+ Sbjct: 434 FRKPFREILYFRCSNLN 450 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,183 Number of Sequences: 438 Number of extensions: 3697 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -