BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-0159 (707 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000050FD82 Cluster: COG0747: ABC-type dipeptide tran... 36 0.74 UniRef50_A7I8F9 Cluster: Multi-sensor signal transduction histid... 33 5.2 >UniRef50_UPI000050FD82 Cluster: COG0747: ABC-type dipeptide transport system, periplasmic component; n=1; Brevibacterium linens BL2|Rep: COG0747: ABC-type dipeptide transport system, periplasmic component - Brevibacterium linens BL2 Length = 515 Score = 36.3 bits (80), Expect = 0.74 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 494 NYIPALLVGTISESD-NNNEYDMHSFNAILDEIPGTSKAKDEESREGRLSNIIF 652 +++P ++ ++ ES N +D +FN + DE+ +AKD RE L +++ Sbjct: 416 DFLPQVIACSLEESPFNETHWDDPTFNKVFDEVRAIPEAKDRRDREHELQKMLY 469 >UniRef50_A7I8F9 Cluster: Multi-sensor signal transduction histidine kinase; n=1; Candidatus Methanoregula boonei 6A8|Rep: Multi-sensor signal transduction histidine kinase - Methanoregula boonei (strain 6A8) Length = 783 Score = 33.5 bits (73), Expect = 5.2 Identities = 17/57 (29%), Positives = 30/57 (52%) Frame = +3 Query: 174 FLSKIYFVVRINIKICYLSSVDYLK*IRSNIFKSQLKYLTLFP*HYYAILLIVGEMG 344 F+S +YFV I C + + K ++ + S+++Y LF AIL++ G+ G Sbjct: 410 FISNVYFVGEKRIIQCNIRDITDRKVVQDEMLASEIRYRRLFETAQDAILILDGDTG 466 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 684,224,870 Number of Sequences: 1657284 Number of extensions: 13404723 Number of successful extensions: 30615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30615 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -